Pocillopora damicornis (lace coral): 113667984 Help Entry 113667984         CDS       T05773                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism pdam  Pocillopora damicornis (lace coral) Pathway pdam04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:pdam00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113667984  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pdam04121]     113667984    03400 DNA repair and recombination proteins [BR:pdam03400]     113667984 Ubiquitin system [BR:pdam04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113667984    Cul5 complex      113667984 DNA repair and recombination proteins [BR:pdam03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113667984 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  113667984 NCBI-ProteinID:  XP_027039663 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEIFVMVRREKTTIFLDCKEATTVYELKKMVEGILKKAPEDQRLYKDDQVLDDTKTLEDC GFTTQTAKAQTPALISLSFRGEDGEFEPVVIAPHSTPPELPDVMKPQETVSNSDGS NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggagatttttgtgatggtgcgtcgtgaaaagacaacaatcttccttgattgtaaggaa gccacaactgtctacgagctaaagaaaatggtcgaaggcatcttaaagaaggctccagaa gatcagaggctgtacaaagatgatcaagtcctggatgatacgaaaactctggaggattgt ggttttacaacccaaaccgcgaaagctcaaactccggcattgattagcttgtcattcaga ggagaagatggagagtttgaaccagttgtgatcgctcctcattccaccccacctgaattg ccagatgtgatgaaaccccaggagactgtttctaacagtgatggctcataa

DBGET integrated database retrieval system