KEGG   Pocillopora damicornis (lace coral): 113671430
Entry
113671430         CDS       T05773                                 

Definition
(RefSeq) serine/threonine-protein kinase/endoribonuclease IRE1-like isoform X1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04140  Autophagy - animal
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113671430
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113671430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113671430
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113671430
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     113671430
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: Other
  IRE family
   113671430
SSDB
Motif
Pfam: Pkinase Ribonuc_2-5A PK_Tyr_Ser-Thr PQQ_2 PQQ Pkinase_fungal PQQ_3 Kdo PH_5
Other DBs
NCBI-GeneID: 113671430
NCBI-ProteinID: XP_027043419
LinkDB
Position
Unknown
AA seq 903 aa
MSRCTIFGLYLGLILFVSWHSVVASEEARTLSVPESLLFISTLDGTMHAVKKQTGDVRWS
LKEDAVIQTPVFLRPGAIFIPDPKDGSLYAFGSAHDGLKKLPFTIPELVRASPCRSSDGI
LYTGRKTDVWYAIDLDTGIKQQTLKLDGTETVCPMMSNKRAPVFLGRTEYMITMYDSKSR
EKRWNATFHDYSSHLAQDVDYDLHHMCSSSDGFMVTMDASTGEILWTKNYGSPVVGIYRM
DNEALLKVKVNHIAKETLKHLIGANTSSSSHQNTFLGDGGEIVLQPTLYIGEHAGGLYAL
PSLVEEGSPLVEAKVLLIEGPRSGVPKTVNPTKSSDAVSAREHSANISPPVRRPVQQPKV
LEPKAALLLGHHQVPLVANPQLHITHIPDKLMPMYMHHHHLHNMKMTPKRIEKTNAREED
RRHQQEMFEMMKIHQRLLYTIIATIGIPVVLLVVFFIERSTRQSAISSKRSSPPSSSSSS
SSSQRVHEQNAEQSPEVLSRLVSVGKISFSLKNVLGRGCEGTVVYKGKFDGRDAAVKRIL
PECFTFADREVDLLRESDAHPNVIRYFCTEEDQQFRYIALELCEATLQEYVEDPTFERHG
LTPVTVLNQAMSGLTHLHSLNIVHRDIKPHNVLISKRSVSGEVKAMISDFGLCKKLAYGR
NSATCQTGAIGTDGWIAPEMFKPDNKMKCSVDIFSSGCVFYYVLSGGLHPFGDQYRRQAN
IVAGDFDVEKIINCELVTEAKDLIRMMLKPCPSERPSAKEILKHPFFWSREKQLAFFQDV
SDRIEKESEESELLVLLQKDSIPVVRGDWKVHLGSELQEDLRKFRTYKGSHVRDLLRAMR
NKKHHYRELPDHVKEALGSVPDGYMRYFSSRFPRLLMHTYNAMASCKSEPVFQTYFSQKE
PLA
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgagcagatgtacaatatttggcttgtatttgggtctgattttgtttgtttcttggcat
tcagtggttgcatctgaagaagctcgtactttgagtgtaccagagtctttactattcata
tcaacgttggatgggacaatgcatgcagtgaagaaacagactggagatgttcggtggtcg
cttaaagaagatgctgtaatacagacaccagtatttcttcgcccaggtgcaatattcatc
cctgatccaaaagatggtagtttatatgcctttggtagtgctcatgatggtctcaagaaa
ctgccatttacaatacctgagttagtgcgggcatctccttgtcgaagttctgatggaatt
ctctacacaggtcgtaaaacagatgtttggtacgctattgacctggacactgggataaaa
caacaaaccttaaagctggatggaacagagactgtttgccccatgatgtccaataagagg
gctccagtatttcttggtagaacagaatatatgataaccatgtatgacagcaaaagcaga
gaaaaaagatggaatgctacatttcatgattattcttcacatcttgcccaagatgttgac
tacgatcttcatcatatgtgttctagttctgatggtttcatggttaccatggacgcatca
acaggagaaattttgtggaccaagaattatggctcccctgtagtgggaatttacagaatg
gacaatgaagccttgctaaaagttaaagtcaatcacatagctaaagagacattgaaacat
cttattggggcaaacacttcaagctcttcacaccaaaacactttccttggagatggtgga
gaaatagttctacagccaacattgtacattggggaacacgctgggggattgtatgctctt
ccatctctggttgaagaaggatcgccattagttgaggcaaaagttttattgattgaaggc
ccaagatcaggtgttcctaaaacagtaaacccaaccaagtccagtgatgcagtatctgcc
agagaacattctgcaaacatttcccctccagtgcggcggcctgtacagcagcccaaagtg
ttggaacccaaagctgcattgcttctgggacaccatcaagttccacttgttgccaaccct
caattgcatatcactcacattcctgataaactgatgccaatgtacatgcatcatcatcat
ctacacaacatgaagatgactccaaagagaattgaaaagacaaatgctagagaggaagac
agacgacatcaacaggagatgtttgagatgatgaaaattcaccagcgactgctatacacc
attatagccactattggaatacctgtggtcttactagttgtgttttttattgagaggtca
acaagacagtctgctatttcatcaaaaagatcgtcacccccttcctcatcatcatcatct
tcatcatcccaaagagtccatgagcaaaatgcagagcaatcacctgaggttttaagtagg
ttagtgtctgtggggaagatctccttctctcttaagaacgttcttggtcgaggctgcgaa
ggaacagttgtctacaagggtaaatttgatggccgcgatgccgcagttaaacgcatttta
ccagaatgtttcacttttgccgatagagaggtggatctattacgtgaatcagatgcccat
ccaaatgtaattcggtatttctgtacggaagaggatcagcaatttcgctatatcgccttg
gaattatgtgaagctacccttcaggagtatgttgaagatccgacttttgagcgccatgga
ctaacacctgtaactgtactgaatcaagccatgtctggactcactcatcttcattctctt
aacattgttcatcgggacatcaaaccacacaatgttctaatttctaagcgatccgtgagc
ggtgaagtgaaggccatgatatctgactttgggctttgtaagaaactggcgtacgggcgg
aactcggccacttgtcaaacaggtgctataggtacagacggctggatagcgcctgagatg
tttaaacctgacaacaaaatgaaatgttctgtggacatcttttcttcgggttgtgttttt
tactacgtgttaagtggaggtctccatccgtttggtgatcagtacagacggcaagctaac
atagtagcgggagattttgatgtagagaagataattaattgtgaattggtcacagaagct
aaagatttaataagaatgatgttaaaaccctgtccttcggagagaccttcagcgaaagaa
atcctgaagcatccattcttctggagcagagaaaaacagcttgcattctttcaggatgtc
agtgatcgaattgagaaagagtccgaagaatcagaactattagtgttattacaaaaggat
tccattcctgtggtgcgaggggactggaaagtacacttaggaagcgaactacaagaagat
cttcgcaaatttaggacttacaaaggctcccatgttagggatcttttacgcgctatgcgg
aacaagaaacatcattaccgtgaattacctgatcacgtgaaggaagcgctcggctctgtt
cctgatggttacatgcgttacttcagctcccgctttccgcgccttctcatgcatacatac
aacgctatggcctcgtgtaagagcgagcctgtgtttcaaacgtacttctctcaaaaagaa
cccctcgcatag

DBGET integrated database retrieval system