KEGG   Pocillopora damicornis (lace coral): 113671903
Entry
113671903         CDS       T05773                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04068  FoxO signaling pathway
pdam04140  Autophagy - animal
pdam04150  mTOR signaling pathway
pdam04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113671903
   04068 FoxO signaling pathway
    113671903
   04150 mTOR signaling pathway
    113671903
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113671903
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113671903
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdam03036]
    113671903
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdam04147]
    113671903
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     113671903
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   113671903
Chromosome and associated proteins [BR:pdam03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     113671903
Exosome [BR:pdam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113671903
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Choline_kinase Haspin_kinase Kdo Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 113671903
NCBI-ProteinID: XP_027043967
LinkDB
Position
Unknown
AA seq 364 aa
MAAPLPPEVVRGQAFDVGPRYTNLSYIGEGAYGMVCSALDNATGQRVAIKKISPFEHQTY
CQRTLREIKILRRFKHENIIGIMDIIRAPNIDDMKDVYIVQSLMETDLYKLLKTQKLSND
HICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPEHDHTGFL
TEYVATRWYRAPEIMLNSKGYSKAIDIWSVGCILAEMLSNRPLFPGKHYLDQLNRILEVL
GSPSQEDLQCIMNEKARSYIQSLAFKPRVPWQRYFPVADNKAIELLDKMLTFNPDKRITI
EEALAHPYLEQYYDPQDEPVAEEPFRFETELDDLPKEKLKELIFIETASYPGSPYLGDFH
HGQQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcggcacctttaccgcctgaagtcgttcggggccaagcattcgatgtaggacctcgc
tatacgaatctcagttacataggagaaggggcttatggaatggtttgttcagcgctggac
aatgccacaggacagagagtggctatcaagaaaatcagtcctttcgagcatcagacgtac
tgtcaacggacattgcgagagattaagatattacgtcgatttaaacacgagaatatcatc
ggaataatggatataatccgcgctccaaacattgatgacatgaaagatgtctacattgtt
cagagcctgatggaaacagacctgtataagttactcaagacacagaaattgagcaatgac
cacatttgctacttcctataccagatcttgcgtggactaaagtacatccactcagccaat
gtgcttcacagggatttgaaaccaagtaatctcttgctgaacacaacatgtgatctcaag
atctgtgactttggcctggcccgtgtagctgatcctgaacatgatcacactggatttttg
actgagtatgttgcaacaaggtggtacagagctcctgagatcatgttgaactccaaaggt
tacagcaaggctattgacatctggtctgtgggctgcattcttgcagagatgttgtcaaat
cgccctctgtttccaggaaagcattacttagatcagttgaaccgcattcttgaagttttg
gggtccccatcacaggaagatttgcagtgtattatgaatgaaaaggcacgtagttacatc
cagtcattagcctttaaaccaagagttccatggcaaagatatttccctgttgctgataac
aaagctatagaactgttagataagatgttaactttcaatcccgacaaacggatcacaata
gaggaagctctggctcatccttaccttgagcagtactatgacccacaagatgagcctgtg
gccgaggagccatttagatttgaaactgagctggatgatcttcccaaagaaaaacttaaa
gaacttatttttattgagactgctagctatcctgggtcaccctaccttggtgactttcac
catggccaacagtga

DBGET integrated database retrieval system