KEGG   Pocillopora damicornis (lace coral): 113673744
Entry
113673744         CDS       T05773                                 

Definition
(RefSeq) ubiquitin recognition factor in ER-associated degradation protein 1-like
  KO
K14016  ubiquitin fusion degradation protein 1
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113673744
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pdam03009]
    113673744
Ribosome biogenesis [BR:pdam03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    113673744
SSDB
Motif
Pfam: UFD1 CDC48_2
Other DBs
NCBI-GeneID: 113673744
NCBI-ProteinID: XP_027045977
LinkDB
Position
Unknown
AA seq 304 aa
MFGFEMFGGVPRTFNTHFRCYSVVMFPGNEREDVERGGKIIMPPSALDQLTRLHIVYPML
FKLSSTKSGRNTHCGVLEFVADEGKIYLPYWMMRNLFCEEGGLLQVESASLPVASYAKFQ
PQSVDFLDITNPKAVLENALRSFACLTKGDVIAIKYNEKIYEFLVLETKPGNAVSIIECD
MQVEFASPVGYVEPERQEKKAEKKEEEQADVPHVEHGFQAFTGSGFRLDGKKKKSNVPSN
PVPIGPPVIKRGIPNYDFEKGKITFKRNLNKSNNSQSNNKGESSKPEFEAFTGSGKTLRQ
KRKN
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtttgggtttgaaatgtttggtggtgtgcctaggacattcaatacacactttcgttgc
tattcagtcgttatgtttccgggaaatgagagagaagacgtggaacgtggcggtaaaatt
ataatgcctccctcagccttggatcaattaacaagacttcacattgtttacccaatgctc
ttcaaattgtccagtacaaaatcaggtagaaatactcattgtggagtactggagtttgtt
gctgatgaaggcaagatttatcttccttactggatgatgcgcaatttattctgtgaagaa
ggtggtttgctacaggtggagagtgcatcactgcctgttgcatcatatgccaagtttcaa
ccacaatcagttgactttttggatatcaccaacccaaaggctgtcttagaaaatgcactc
aggtcatttgcctgtctcactaaaggtgatgtaattgcaatcaagtacaatgaaaagatt
tatgagtttttggttcttgaaacaaaacctggaaatgcagtgtcaattatcgagtgtgat
atgcaggttgagtttgcctcacctgttggatatgttgaaccagaaaggcaagagaaaaag
gctgagaaaaaagaagaagaacaagctgatgtaccgcatgtggaacatggtttccaggct
tttactggttcaggatttcgcttggacgggaagaaaaagaagtcaaatgttccgtctaat
ccggtaccaattggtcctcctgttattaagaggggaattcctaattacgacttcgaaaaa
gggaagattacttttaaaaggaacttaaacaaatcgaacaactcacagtcgaataacaag
ggagaatctagtaagccagaatttgaagcttttacagggtcaggaaaaacgctacgacaa
aagaggaaaaattag

DBGET integrated database retrieval system