KEGG   Pocillopora damicornis (lace coral): 113678513
Entry
113678513         CDS       T05773                                 

Definition
(RefSeq) serine/threonine-protein kinase TBK1-like
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113678513
   04137 Mitophagy - animal
    113678513
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113678513
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113678513
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     113678513
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   113678513
Membrane trafficking [BR:pdam04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    113678513
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TBK1_ULD TBK1_CCD1 Kinase-like ABC1 ubiquitin Kdo DUF2400
Other DBs
NCBI-GeneID: 113678513
NCBI-ProteinID: XP_027051194
LinkDB
Position
Unknown
AA seq 785 aa
MEIRSSTNYAWNTKDRLGEGATGAVYKARHKKTGETFAVKVSNNLGMMRPVEIRRREFEV
LTKLNHENIVKLYASETELRSQNEIIVMELCSGGSLFTLLENPANAYGFMEDEFKQVLKD
VVAGMKHLHEQGMVHRDLKPGNIMRVIKDDGSFVYKLTDFGAARELEAHEVFMSVYGTEE
YLHPDLYERGVLRKHANKTFGAMVDLWSIGVTFYHIATGQLPFRPYGGRQNKDTMHVITS
KKRSGMISGVQKSEGEDIEWSDKLPDHTRLSQGLKELLTPVLAGILESDPANAMSFGKFF
VSIQDILSRKVIDVYSVHSASFHKIYMKQSDTFAKFQELIAVQTGVSAAQQKLFFKYDEF
KPDPMAPSSSYPKTSDDIFMVMTGGEYMSPERLSLYKITNLLKLPTESTLEVDSSTSKMM
ANRAQCCKYAVKQYFRATKAMLVTIESVLKNLKKDMMFYVSFCKQMESEWTALQQISEAY
YTSQMHHAWVFDALLSKLTEPKDEVKVILEEVQDIQKWSESKKESEGELNKAYQRNDRMK
TLISEVIETDRFRAFLEDFTKDTDDQSFFNLVSTYTGNIEEIYQSFRKDKYHRRLSYADE
QRHKFDREKLVVMSDKITKITEEAVKHRSALHEKLVGWLNEVNHCYEEAESLHSSFLGQK
QAQDAFLISLRSVQEQCLEKSKRIVEKLQKLITSPSPVLTATAPAAAAQNGYADPDMNSI
TVNQLGNELDSLSMITKEAVQTAQQNTQQIERVVRGFITLYTSLNEHMSKDVSQLEETIG
EENMN
NT seq 2358 nt   +upstreamnt  +downstreamnt
atggagatacgaagcagtacgaactacgcttggaacacaaaagatcgtttgggcgaagga
gcgacaggggcagtttacaaagcccgacacaagaaaactggtgaaacatttgcagtgaaa
gtttctaataatctggggatgatgagaccagtagagataaggagaagagagtttgaggtg
ctgaccaagttgaatcatgagaatatagtaaagttgtatgctagtgaaaccgagctcaga
tcgcaaaatgagatcatcgtcatggagttgtgctcaggtggcagcttgtttacactgctt
gaaaatcctgcaaatgcctatggctttatggaagatgaatttaaacaagtgcttaaagac
gttgttgcaggaatgaagcacttacatgaacaaggcatggttcacagagatctcaagcct
gggaacatcatgagagtgattaaggatgatggaagctttgtttacaagttaactgatttt
ggggctgcaagggaactggaagctcatgaagtcttcatgtctgtgtacggcacagaggaa
tatttgcatccagatctctatgaaagaggagtgctcaggaaacatgcaaacaagacattt
ggtgcaatggttgacttgtggagcattggggtaactttttaccatattgctacaggacag
ttgcccttcagaccatatggtgggcgacagaacaaggataccatgcatgtgatcacatct
aagaagcggtctggtatgatttctggagttcagaagagtgagggggaggacattgagtgg
agtgacaaacttcctgatcatacacgattgtctcagggtctgaaagaactcttgacacca
gtattggctggtattttggaatctgacccagcaaatgcaatgtcgtttggaaagtttttt
gtcagtattcaagacattttgtcacggaaggtcatcgatgtttattcggtgcattcagct
tctttccacaagatctacatgaagcagagtgatacctttgcaaagttccaggaactcatt
gcagtacaaacaggagtcagtgctgctcagcagaaattgttttttaagtacgatgagttc
aagccagatcccatggctccttcgtcatcctatcctaagacatctgatgacatcttcatg
gtgatgactggaggagaatacatgtctccagagcgattatccctttacaaaatcaccaat
ctcctcaaactaccaacggaaagcactttggaagtagattcatctacttcaaagatgatg
gcaaatcgtgcacagtgctgcaagtatgcagtcaaacaatacttcagggcaactaaggca
atgctggtgaccattgaaagcgtcttaaaaaatctcaagaaggatatgatgttttatgtt
tctttctgtaaacaaatggaatcagaatggactgccctacaacagatctctgaagcctat
tacacaagccagatgcaccatgcctgggtgtttgacgctctcctgtcaaaactaacagaa
ccaaaggatgaggtgaaagtgattttggaggaagtgcaagacatacagaagtggtcagag
agtaagaaagagagtgagggggagttgaacaaagcctaccagagaaatgacaggatgaag
acacttatctctgaagtcatagagactgacagattccgtgctttcttggaagacttcacg
aaggacaccgatgaccagtccttcttcaatttggtgtctacatatacaggaaacattgaa
gaaatttaccagagctttcggaaagacaaataccacaggagactttcgtatgcagatgaa
caaagacacaagtttgaccgggagaagttggttgtcatgagcgataagatcaccaaaatt
actgaagaagctgtgaaacacagaagtgcattacatgaaaagcttgtggggtggcttaat
gaagtaaaccactgttatgaagaggcagaaagcttgcattcttcatttctgggccagaag
caagctcaagatgcttttcttatttcgttgcgatcggttcaagaacaatgcctagagaag
tcgaaaaggattgttgagaagctccagaaactcatcacctctccaagcccagtactgact
gcaacagcgccagctgcagccgcccagaatggttatgctgatccggatatgaatagtatc
accgtgaaccaacttgggaatgaacttgattcgctgtcaatgataactaaagaagcagtc
caaacagctcaacaaaacacccaacaaattgaaagggttgtcagaggttttattacgctg
tatacatcactcaacgaacacatgtcgaaagacgtcagccaacttgaggaaaccatcggc
gaggaaaacatgaactag

DBGET integrated database retrieval system