KEGG   Pocillopora damicornis (lace coral): 113682248
Entry
113682248         CDS       T05773                                 

Name
(RefSeq) caspase-3-like
  KO
K04489  caspase 3A [EC:3.4.22.-]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    113682248
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdam01002]
    113682248
Enzymes [BR:pdam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     113682248
Peptidases and inhibitors [BR:pdam01002]
 Cysteine peptidases
  Family C14: caspase family
   113682248
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 113682248
NCBI-ProteinID: XP_027055203
LinkDB
Position
Unknown
AA seq 259 aa
IHLIFISLIFLLAHAPFQESGDDIDLKVKSGYVLVIHNYSFPKREEAVRHGSEEDVKNLC
SLFDDFNFKTRIVNNLTQSQMVEILSETAEKDFSRYDCFLCVILSHGLKDGILGIDDEKI
KIEAITSNFRRDACPSLEGKPKIFLIQACRGNRQDRVSIESDSEPVPCASSSLPADADFL
ICFASAPGHQSYRQPELGSWFISTVVAIFKEYAEREHLMDMMLRVNNHVANYFSKTGLKQ
IPCQVCMLRRKVYFSPKYN
NT seq 780 nt   +upstreamnt  +downstreamnt
attcacttaatattcatttcacttatttttcttctagctcatgcaccttttcaagagtct
ggggatgatattgatttaaaagtaaagtctggttatgtgttagtaattcataactacagc
ttccctaagagggaggaggctgtacgccatgggtcagaggaagatgtgaaaaatctttgt
agcctctttgatgatttcaacttcaaaacccgaattgtaaataacttgactcaaagtcag
atggtggaaatactcagtgaaactgcagagaaagacttcagcagatatgattgtttcttg
tgtgtaatcctcagccatggtctcaaagatgggattcttggaattgatgatgagaagatt
aaaattgaagcaatcacttccaattttcgccgagatgcatgtccttctcttgaggggaaa
ccaaaaatatttctgatccaagcttgccgtggcaatagacaggatagggtatctatcgag
agcgacagtgagcctgtcccatgtgcaagctcatctcttccagctgatgctgattttctg
atctgttttgcctctgcccctggtcaccaaagctacaggcagccagagcttggttcttgg
ttcatttcaacagttgtggcaatttttaaagagtatgcagaaagggagcatcttatggat
atgatgctgagagtcaacaatcatgttgcaaattatttcagcaaaacaggcctcaagcaa
ataccctgccaagtctgcatgctgagaaggaaagtgtattttagtccaaaatataattaa

DBGET integrated database retrieval system