KEGG   Pocillopora damicornis (lace coral): 113683021
Entry
113683021         CDS       T05773                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04140  Autophagy - animal
pdam04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113683021
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113683021
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdam01001]
    113683021
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdam03019]
    113683021
   03036 Chromosome and associated proteins [BR:pdam03036]
    113683021
Enzymes [BR:pdam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     113683021
Protein kinases [BR:pdam01001]
 Serine/threonine kinases: AGC group
  PKA family
   113683021
Messenger RNA biogenesis [BR:pdam03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     113683021
Chromosome and associated proteins [BR:pdam03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    113683021
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Haspin_kinase
Other DBs
NCBI-GeneID: 113683021
NCBI-ProteinID: XP_027056023
LinkDB
Position
Unknown
AA seq 349 aa
MGNTPTKRGDPENVKAFLTEAKEEFNQKWDHPSQNTASLEDFERLKTLGTGSFGRVMLVQ
HKSSNKFYAMKILDKQKVVKLKQVEHTLNEKRILQAITFPFLVNLEWHFKDNSNLYMVLE
FVLGGEMFSHLRRIGRFSETHSRFYASQIVLAFEYLHSLDLIYRDLKPENLLIDEKGYLK
VTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFAD
QPIQIYEKIVSGKVRFPSHFTADLKDLLRNLLQVDLTKRYGNLKNGVGDIRGHKWFSSTD
WIAIYQRKVEAPFIPKCKGPGDPSNFDDYEEEPLRISTSEKCAKEFADF
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgggcaacactccgacaaagagaggagacccagaaaatgtaaaagctttcctgaccgag
gccaaagaggagttcaatcaaaaatgggaccatccctctcagaatacggctagtttggag
gacttcgagcgattgaagaccctgggtaccggatcatttggtcgggttatgctcgttcaa
cataagagcagcaacaaattttatgctatgaaaattttagataaacagaaggtggtgaag
ttgaagcaagtggaacatactttgaatgaaaaaaggattctgcaagcgataacttttcca
ttcctggtgaacctggaatggcattttaaggataattccaacttgtacatggttctggaa
tttgttcttggtggtgagatgttttctcatctacgacgtattggaagattcagtgaaaca
cactcaaggttttacgcttcacaaattgttttggcatttgagtatcttcactctctagac
cttatatacagggatctaaaaccagagaatcttctcattgacgagaaaggttacttaaag
gtaacagattttgggtttgccaagagagtcaaagggagaacgtggacgctttgcggcact
ccagaatacctagctcctgagatcatcctcagcaagggttacaacaaggctgtagattgg
tgggcattaggtgtccttatctatgaaatggcagctggttaccctcctttctttgctgac
cagccaattcagatctatgaaaagattgtctctggcaaggtacgtttcccatctcatttc
acagctgatctgaaagacttgcttcgaaatttattgcaagttgacctaacaaaaagatac
gggaatctaaagaatggtgtgggagacatccgtggtcacaagtggttcagttccacagac
tggatagctatctatcaaagaaaagttgaagccccctttattcccaagtgcaaaggtcca
ggagatccaagcaattttgacgattatgaggaagaaccactgcgcatctctacctctgag
aagtgcgcaaaagaatttgcagatttctga

DBGET integrated database retrieval system