KEGG   Pocillopora damicornis (lace coral): 113683087
Entry
113683087         CDS       T05773                                 

Definition
(RefSeq) small VCP/p97-interacting protein-like
  KO
K14014  small VCP/p97-interacting protein
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113683087
SSDB
Motif
Pfam: SVIP
Other DBs
NCBI-GeneID: 113683087
NCBI-ProteinID: XP_027056089
LinkDB
Position
Unknown
AA seq 87 aa
MGNCYDCFSSQPEVETPDPEIRRRQQEEAALKRQQQADGRGVKDPERLKRQQKRREDAER
EALKHGPSDGGLKVSTFWHEQVHLLYF
NT seq 264 nt   +upstreamnt  +downstreamnt
atgggaaattgttacgattgttttagctcacaaccagaggttgaaaccccggatccggaa
attagaagacgacagcaagaggaggcagcgttgaagcgacagcaacaagctgatggtcgt
ggagttaaggatccagagagactgaagagacaacagaaacgaagagaggatgctgagagg
gaggctttgaagcatggtccttctgatgggggattaaaggttagcacattttggcatgaa
caagttcatcttttatatttttaa

DBGET integrated database retrieval system