KEGG   Pocillopora damicornis (lace coral): 113685608
Entry
113685608         CDS       T05773                                 

Definition
(RefSeq) ras-related protein rab7 isoform X1
  KO
K07897  Ras-related protein Rab-7A
Organism
pdam  Pocillopora damicornis (lace coral)
Pathway
pdam04137  Mitophagy - animal
pdam04140  Autophagy - animal
pdam04144  Endocytosis
pdam04145  Phagosome
Brite
KEGG Orthology (KO) [BR:pdam00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113685608
   04145 Phagosome
    113685608
   04140 Autophagy - animal
    113685608
   04137 Mitophagy - animal
    113685608
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdam04131]
    113685608
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdam04147]
    113685608
   04031 GTP-binding proteins [BR:pdam04031]
    113685608
Membrane trafficking [BR:pdam04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    113685608
Exosome [BR:pdam04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113685608
  Exosomal proteins of other body fluids (saliva and urine)
   113685608
  Exosomal proteins of colorectal cancer cells
   113685608
  Exosomal proteins of bladder cancer cells
   113685608
GTP-binding proteins [BR:pdam04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    113685608
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase cobW ATP_bind_1 AAA_22 Septin AAA_16 NTPase_1 AAA_7 PduV-EutP SRPRB AAA_24 AAA_5 ATPase_2 Glyco_hydro_75 DAP3 NB-ARC G-alpha NACHT TniB
Other DBs
NCBI-GeneID: 113685608
NCBI-ProteinID: XP_027058940
LinkDB
Position
Unknown
AA seq 208 aa
MLSMASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLV
TMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTQPTTFKTLDSWRDEFLIQASPRDPEN
FPFVVLGNKIDLENRVVMAKRAQAWCHSKNDIPYFETSAKEAINVEQAFQTIAKNALAQE
TEVELYNDFPDQIRLSNDNKPNSKDCAC
NT seq 627 nt   +upstreamnt  +downstreamnt
atgttaagcatggcatcaagaaagaaggttcttctgaaagtcattatcttgggtgatagt
ggggttggaaagacatcacttatgaaccagtatgtcaacaaaaaatttagcaatcaatac
aaggcaacaattggagctgacttcctcacaaaagaagtcatggtagatgacaggctagtt
acaatgcagatatgggacacagctggacaagagagatttcaaagcttgggagtggcattt
taccgaggtgcagactgttgtgtcctggtctttgatgtgactcaacctacaacattcaag
acactagacagttggagagatgagttccttattcaagccagcccacgtgatcctgaaaac
tttcctttcgtggtcttaggaaacaaaattgacctggaaaacagagtggtcatggccaaa
cgcgcacaagcttggtgccactcaaagaatgacattccatactttgagaccagcgccaaa
gaagccatcaatgtggagcaagctttccagaccattgctaaaaatgctcttgctcaagag
acagaggttgaattatacaatgatttcccagaccaaataagactctcaaatgacaacaaa
cctaactcaaaggactgtgcctgttga

DBGET integrated database retrieval system