Clostridioides difficile 630: CDIF630_01202 Help Entry CDIF630_01202     CDS       T03885                                  Symbol acpP1 Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism pdc  Clostridioides difficile 630 Pathway pdc01100   Metabolic pathways pdc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDIF630_01202 (acpP1)    00074 Mycolic acid biosynthesis     CDIF630_01202 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDIF630_01202 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 PRD Motif Other DBs NCBI-ProteinID:  AJP10748 UniProt:  Q18AR4 LinkDB All DBs Position complement(1239831..1240058) Genome browser AA seq 75 aa AA seqDB search MFEKIKEIIAEQLGVDNLDEITMEASLMDDLEADSLDAVEIIMALEDEFGIEIPDEEAEN FKCIGDICKYIEENK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtttgagaaaataaaagaaataatagcagaacaattaggggtagacaatttagatgag ataactatggaagcatctttaatggacgacttagaagctgattcattagatgctgttgaa attataatggcccttgaagatgaatttggaatagaaataccagacgaggaagctgagaac tttaaatgtattggtgatatatgtaaatatatcgaagaaaacaaatag

DBGET integrated database retrieval system