Pseudoxanthomonas daejeonensis: MNQ95_03695 Help Entry MNQ95_03695       CDS       T08066                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pdd  Pseudoxanthomonas daejeonensis Brite KEGG Orthology (KO) [BR:pdd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pdd03036]     MNQ95_03695 Chromosome and associated proteins [BR:pdd03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     MNQ95_03695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB COG6_N Taxilin bZIP_1 GAS SKA2 YabA Dynamitin Wtap Stathmin FlgN bZIP_2 DUF7603 Herpes_BLRF2 NRBF2 Troponin DUF7491 Mod_r CENPH TMPIT FAZ1_C DUF3450 EMP24_GP25L FapA MctB DUF2203 Nup88 Shugoshin_N Motif Other DBs NCBI-ProteinID:  UNK58218 LinkDB All DBs Position 794518..794742 Genome browser AA seq 74 aa AA seqDB search MDSSADATAQLRALATRVEALAERCQRLADENRSLRQQQEQLFTERAQLLNKNEQARSRV EAMIARLKSLEQHT NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggattcctccgccgacgccaccgcccagctccgcgccctcgccacgcgggtcgaggcg ctggccgagcgttgccagcgcctggccgacgagaaccgcagcctgcgccagcagcaggag cagctgttcaccgagcgcgcccagctgctcaacaagaacgagcaggcgcgctcgcgcgtg gaagcaatgatcgcgcggctgaaatcgctggagcagcacacgtga

DBGET integrated database retrieval system