Paracoccus denitrificans: Pden_1768 Help Entry Pden_1768         CDS       T00440                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pde  Paracoccus denitrificans Pathway pde01100   Metabolic pathways pde01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pde00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pden_1768    00074 Mycolic acid biosynthesis     Pden_1768   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pden_1768 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ABL69865 UniProt:  A1B2X1 LinkDB All DBs Position 1:complement(1757265..1757498) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEEKVTETASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIQGAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaagaaaattgtcgtcgagcacctgggtgtcgatgaa gagaaggtgacggaaaccgcctcgttcatcgacgatctcggcgccgattcgctggatacc gtcgaactggtcatggctttcgaggaagagttcggcatcgagatcccggacgatgccgcc gagaccatccagaccttcggcgacgcggtgaaattcatccagggcgcggtctga

DBGET integrated database retrieval system