Paracoccus denitrificans: Pden_2586 Help Entry Pden_2586         CDS       T00440                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pde  Paracoccus denitrificans Brite KEGG Orthology (KO) [BR:pde00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pde03110]     Pden_2586 Chaperones and folding catalysts [BR:pde03110]  Protein folding catalysts   Protein disulfide isomerase    Pden_2586 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Thioredoxin_3 CBD_PlyG GST_N Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  ABL70673 UniProt:  A1B579 LinkDB All DBs Position 1:2597986..2598252 Genome browser AA seq 88 aa AA seqDB search MMAKIEIYTTPTCPYCIAAKSLLQKKGITYEETDVSCDPQLRIAMTQRAGGRRTVPQIFI DGQHVGGSDDLHALEHRGKLDGLLGLTA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgatggccaagatcgagatctacaccacccccacctgtccctattgcatcgccgcgaaa tcgctgctgcaaaagaagggcattacctatgaggaaaccgatgtcagctgcgatccgcaa ctgcgcatcgcgatgacccagcgcgccggcgggcgccgcaccgtgccgcagatcttcatc gacggccagcatgtcggcggcagcgacgacctgcacgcactggagcatcggggcaagctg gacggattgctgggcctgacggcatga

DBGET integrated database retrieval system