Planococcus dechangensis: H1Q58_10090 Help Entry H1Q58_10090       CDS       T07033                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdec  Planococcus dechangensis Pathway pdec01100   Metabolic pathways pdec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdec00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H1Q58_10090    00074 Mycolic acid biosynthesis     H1Q58_10090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H1Q58_10090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  QMT16328 UniProt:  A0A150W7Y9 LinkDB All DBs Position complement(2003313..2003549) Genome browser AA seq 78 aa AA seqDB search MSTVLERVTKVIVDRLGVEESEVKPEASFTNDLGADSLDVVELVMELEDEFDMEISDEDA EGMATVGDAVTYIEKQQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt ttgtcaacagtattggaacgcgtaaccaaagtaatcgtagatcgtcttggtgtggaagaa agcgaagtgaaacctgaagcatctttcacaaacgaccttggagcggattcattggatgta gttgaattggtcatggagctagaagacgaattcgatatggaaatttccgatgaagatgca gaaggaatggcaacagtaggcgacgcagtaacttacatcgaaaaacaacaagcttaa

DBGET integrated database retrieval system