KEGG   Pseudarthrobacter defluvii: JCQ34_07800
Entry
JCQ34_07800       CDS       T09165                                 
Name
(GenBank) M56 family metallopeptidase
  KO
K02172  bla regulator protein blaR1
Organism
pdel  Pseudarthrobacter defluvii
Pathway
pdel01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pdel00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    JCQ34_07800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pdel01002]
    JCQ34_07800
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:pdel01504]
    JCQ34_07800
Peptidases and inhibitors [BR:pdel01002]
 Metallo peptidases
  Family M56
   JCQ34_07800
Antimicrobial resistance genes [BR:pdel01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    JCQ34_07800
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M56 SprT-like DUF6782
Other DBs
NCBI-ProteinID: WJH25941
LinkDB
Position
complement(1702405..1703397)
AA seq 330 aa
MFWASYLLAVLAIVLAWPVPILLSRAQWPARSPFTAMLLWQAIALAGGLSMIGAMLVYGL
EPIGDNLIAGLRGLAGMVLFNAPTTALGFWHIFALSTAALLTVHLVFTLLLTYYKIQRQR
RRHREMLALLASPSGQDAGTLVISHDSPVAYCLPGGARSVTVLSDGLMAALEPAELRAVL
IHENAHLSQRHHLLLWAFAAWRQALPWLPTTRLAQESVNSLIEMLADDVALRTESKATLI
KAIAIVASGSATEAGAGSVRPSSPTLALSGLEAASGGSGSDAVRTAASRVSRLLTPQPPL
PSALRSAVMAGSVLLLALPTALLVVPGLLG
NT seq 993 nt   +upstreamnt  +downstreamnt
atgttctgggcctcatacctgctggcggtccttgcgatagtcctggcgtggccggtgccg
atcctcctgtcacgggcgcaatggccggccaggtcgccgttcacggccatgctgctgtgg
caggcgatcgcgctagcaggcgggctgtccatgatcggcgccatgttggtctacggcctg
gagcccatcggcgacaacctcatcgcaggcctccgcggccttgccggcatggtgcttttc
aacgcccccactacagccctggggttctggcacatctttgccctgtccactgccgccctg
ctcaccgtccacctggtgttcaccctgctgctgacgtactacaagatccagcggcagcgg
cggcggcaccgcgaaatgcttgccctgctggcgtcgccctccggccaggacgccgggacc
ctggtcatcagccacgactcccccgtggcgtactgccttcccggcggcgcgcgttccgtg
acagtcctgtcggacggcctgatggcggcgctcgaaccggcagaacttcgggccgtgctg
attcacgagaacgcccacctgagccagcggcaccacctcctgctctgggccttcgccgcg
tggcggcaggcccttccgtggctgcccaccacccggcttgcccaggaatccgtgaactcc
ctcatcgagatgctggccgatgatgtcgccctgcggaccgagagcaaagccaccctcatc
aaggccatcgccatcgtggccagcggttccgccacggaggccggcgccggaagcgtccgg
ccatcctcgcccacgctggccctgtccgggcttgaggcggcgtcgggcggatccggttcg
gatgcggtccgcaccgcagcttcccgtgtcagccggctcctgacgccccagcctccgctt
ccttccgccctccgcagcgccgttatggcaggcagcgtcctgctgctcgcgctgcccacc
gcgctcctggtggttcccggactgctcggctga

DBGET integrated database retrieval system