Pseudomonas denitrificans (nom. rej.): F1C79_12670 Help Entry F1C79_12670       CDS       T09478                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pden  Pseudomonas denitrificans (nom. rej.) Brite KEGG Orthology (KO) [BR:pden00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pden03032]     F1C79_12670    03036 Chromosome and associated proteins [BR:pden03036]     F1C79_12670    03400 DNA repair and recombination proteins [BR:pden03400]     F1C79_12670 DNA replication proteins [BR:pden03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     F1C79_12670 Chromosome and associated proteins [BR:pden03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     F1C79_12670 DNA repair and recombination proteins [BR:pden03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       F1C79_12670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 SSPI Motif Other DBs NCBI-ProteinID:  QEY72388 UniProt:  A0A9X7MZL4 LinkDB All DBs Position complement(2824049..2824327) Genome browser AA seq 92 aa AA seqDB search MPMTKDQLVRDIAESLDLTQAAVRGVFEQLAQIAQDALENDGELTLPGIGKLKVSERAAR TGRNPQTGKTIEIAAKKAVRLVPAKALVDSLN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcccatgaccaaggaccaactggttcgtgatatcgccgaatccctcgacctgacccag gccgccgtgcgcggcgtgttcgagcaactggcgcagatcgcccaggacgccctggagaac gacggtgagctgaccctgccggggatcggcaagctcaaggtcagtgaacgcgctgcccgc accggccgcaacccgcagaccggcaagaccatcgagatcgccgcgaagaaggcggtacgc ctggtgcctgccaaggccctggtcgacagcctgaactga

DBGET integrated database retrieval system