Pseudomonas denitrificans (nom. rej.): F1C79_13455 Help Entry F1C79_13455       CDS       T09478                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pden  Pseudomonas denitrificans (nom. rej.) Pathway pden01100   Metabolic pathways pden01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pden00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F1C79_13455 (acpP)    00074 Mycolic acid biosynthesis     F1C79_13455 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F1C79_13455 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QEY72527 UniProt:  A0A9X7MZM8 LinkDB All DBs Position complement(2982085..2982321) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYIVAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaagatcgttgctgagcaactcggcgttaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccccgacgagcaagcc gaaaagatcaccaccgttcaggaagccatcgactacatcgttgcccaccaggcataa

DBGET integrated database retrieval system