Pseudomonas denitrificans (nom. rej.): F1C79_21410 Help Entry F1C79_21410       CDS       T09478                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pden  Pseudomonas denitrificans (nom. rej.) Pathway pden01100   Metabolic pathways pden01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pden00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F1C79_21410    00074 Mycolic acid biosynthesis     F1C79_21410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F1C79_21410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ub-Mut7C DUF3072 DUF1493 Motif Other DBs NCBI-ProteinID:  QEY73952 UniProt:  A0A9X7N2G7 LinkDB All DBs Position 4633649..4633897 Genome browser AA seq 82 aa AA seqDB search MQTREDIFNTLRDALVELFELEPEQISLDANLYQDLEIDSIDAVDLIDHLKRQTGKKIAA EEFKSVRTVGDVVEAVYRLANP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgaggacattttcaacaccctgcgcgacgccctggtcgagctgttcgaa ctggagccggagcagatcagcctcgacgccaacctgtaccaggacctggagatcgacagc atcgacgccgtcgacctgatcgaccacctcaagcgccagaccggcaagaagatcgccgcc gaggaattcaagtcggtgcgtaccgtcggcgacgtggtcgaagcggtctatcgcctggcc aacccatga

DBGET integrated database retrieval system