Pseudomonas denitrificans (nom. rej.): F1C79_21505
Help
Entry
F1C79_21505 CDS
T09478
Name
(GenBank) LysR family transcriptional regulator
Organism
pden
Pseudomonas denitrificans (nom. rej.)
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LysR_substrate
HTH_1
PBP_like_2
HTH_24
HemN_C
Motif
Other DBs
NCBI-ProteinID:
QEY73970
UniProt:
A0A9X7N5C0
LinkDB
All DBs
Position
complement(4651030..4651923)
Genome browser
AA seq
297 aa
AA seq
DB search
MELRHLRYFIAVAEELHFGRAAEQLGISQPPLSQQIQALEEEIGARLLERTNRRVALTEA
GKLFLDEARQVLQQVDRAVLLARRAHQGEIGELKVGFTASAPFTSSIPRAILAFRQAYPD
VHLDLQELSSGQAVQALLEERVQVGLIRPIPLPETLEAVELFSEPLVAVLRADHPLAQAS
QEGLEFALLADEPFVFFPRSYGTGLYSQLMALSRQAGFSPRIAQEAGEAMTIIGLVAAGL
GVSMLPASFRRTRVDGVVYRTLSDPGATSSVWLVRRRNETSRLAQSFFDLVTQQIQA
NT seq
894 nt
NT seq
+upstream
nt +downstream
nt
atggaactgcgacacctgcgttatttcatcgccgtggcggaagagctgcacttcggccgc
gccgccgagcagctggggatttcccagccgccgctgagccagcagatccaggcgctggag
gaggaaatcggcgcgcggctgctggagcgcaccaaccgccgcgtggcgctgaccgaggcc
ggcaagctgtttctcgacgaagcgcggcaggtgttgcagcaggtggaccgtgccgtcttg
ctggcgcggcgtgcgcaccagggcgagatcggcgagctgaaggttggcttcaccgcctcg
gcgccgttcacctccagcatcccgcgcgccatcctggcattccgtcaggcctacccggac
gtgcacctggacctgcaggaactgagcagcgggcaagcggtgcaggcgctgctggaagag
cgcgtgcaggttggcctgatccggcccatcccgttgccggaaaccctggaagccgtggag
ctgttcagcgagccgctggtggccgtgctgcgcgctgatcatccgctggcgcaggccagc
caggaggggctggagttcgccttgctggcggacgagccgttcgtgtttttcccgcgcagc
tacggcacgggcctctacagccagctgatggcgctgtcgcggcaggccggcttcagcccg
cgcatcgcccaggaagcgggcgaggcgatgaccatcatcggcctggtggcagcggggctc
ggtgtgtcgatgctgccggcgtcgttccgccggacgcgggtggatggcgtggtctatcgc
accctcagcgatccgggcgcgaccagttcggtgtggctggtgcggcgacgcaacgagacg
tcacgcctggcgcagtcgttcttcgacctggtgacccagcaaatccaggcctga
DBGET
integrated database retrieval system