Peteryoungia desertarenae: FE840_010860 Help Entry FE840_010860      CDS       T07298                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdes  Peteryoungia desertarenae Pathway pdes01100   Metabolic pathways pdes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FE840_010860    00074 Mycolic acid biosynthesis     FE840_010860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FE840_010860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Delta_lysin Motif Other DBs NCBI-ProteinID:  QLF69995 UniProt:  A0ABX6QN91 LinkDB All DBs Position 2234705..2234941 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVDHLGVDADKVVEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgttaagaaaattgtagttgatcatctcggcgttgacgct gacaaggttgtcgaaggcgcgagcttcatcgacgatctgggcgctgactcgctcgacacc gtcgaactcgtcatggctttcgaagaagaattcggcgtggaaatcccggacgacgctgct gactcgatcctgactgtcggcgatgccgtgaagttcatcgagaaggcccaggcctaa

DBGET integrated database retrieval system