Pseudomonas defluvii: QEP73_03885 Help Entry QEP73_03885       CDS       T10501                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pdeu  Pseudomonas defluvii Brite KEGG Orthology (KO) [BR:pdeu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pdeu03036]     QEP73_03885 Chromosome and associated proteins [BR:pdeu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     QEP73_03885 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Filament Asd-4 ZapB_rel TPR_MLP1_2 KIF21A_2nd ADIP ZapB Motif Other DBs NCBI-ProteinID:  WJM97280 LinkDB All DBs Position 845686..845895 Genome browser AA seq 69 aa AA seqDB search MQETELQALMGRLELLIERVEQLKRQNALLLAQEKSWREERAHLIEKNEIARRKVESMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcaagagaccgagctgcaagcgctgatgggccgactcgaactgttgattgaacgggtc gagcaactaaaacggcaaaacgcactcttattagctcaggaaaaatcctggcgtgaggaa cgtgcccacctcatcgaaaaaaatgaaatcgcccggcgtaaggtcgaatcgatgattttg cgactcaaggccctggagcaagactcatga

DBGET integrated database retrieval system