Planococcus donghaensis: BCM40_06275 Help Entry BCM40_06275       CDS       T04451                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pdg  Planococcus donghaensis Brite KEGG Orthology (KO) [BR:pdg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pdg03032]     BCM40_06275    03036 Chromosome and associated proteins [BR:pdg03036]     BCM40_06275    03400 DNA repair and recombination proteins [BR:pdg03400]     BCM40_06275 DNA replication proteins [BR:pdg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BCM40_06275 Chromosome and associated proteins [BR:pdg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BCM40_06275 DNA repair and recombination proteins [BR:pdg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BCM40_06275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_2 Rpf1_C Motif Other DBs NCBI-ProteinID:  ANU22998 UniProt:  A0A1C7EGU3 LinkDB All DBs Position complement(1972826..1973098) Genome browser AA seq 90 aa AA seqDB search MNKTELVNSVAEAAELSRKDAAKAVDAAFETIQDALTKGEKVQLIGFGNFEVRERAARKG RNPQTGAEIEIAASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattagtgaactctgttgctgaagcagctgaactttctcgtaaagac gctgccaaagcagttgacgctgcatttgagacgattcaagacgctttaactaagggtgaa aaagtacagttgatcggattcggtaactttgaagtacgcgaacgcgcggcccgcaaagga cgtaacccgcaaactggtgctgaaatcgagatcgctgcaagcaaagttcctgcatttaag ccaggtaaagcgcttaaagacgcagtgaagtaa

DBGET integrated database retrieval system