Paenibacillus donghaensis: B9T62_14785 Help Entry B9T62_14785       CDS       T04971                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pdh  Paenibacillus donghaensis Pathway pdh02024   Quorum sensing pdh03018   RNA degradation Brite KEGG Orthology (KO) [BR:pdh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     B9T62_14785  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     B9T62_14785  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pdh03019]     B9T62_14785    03036 Chromosome and associated proteins [BR:pdh03036]     B9T62_14785 Messenger RNA biogenesis [BR:pdh03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      B9T62_14785 Chromosome and associated proteins [BR:pdh03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     B9T62_14785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ASA21930 UniProt:  A0A2Z2KFN8 LinkDB All DBs Position complement(3378346..3378588) Genome browser AA seq 80 aa AA seqDB search MNKSINIQDTFLNQLRKENIPATVYLTNGFQIRGIIKAFDNFTIVIDSDGRQQMVYKHAI STFTPQRSVSLMQDNGGSEE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtccattaacatccaagatacgttcttgaaccaactgcgcaaagagaatatc cctgctacagtatatttgaccaacggctttcagatccgggggattattaaagcgtttgac aatttcaccatcgtcattgacagtgacggacgccagcagatggtgtacaagcatgcgatt tccaccttcactccgcagcgcagtgtatcactgatgcaggataacggcggaagcgaagaa taa

DBGET integrated database retrieval system