Phyllostomus discolor (pale spear-nosed bat): 114488197
Help
Entry
114488197 CDS
T07739
Symbol
PSMD7
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 7
KO
K03038
26S proteasome regulatory subunit N8
Organism
pdic
Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic03050
Proteasome
pdic05010
Alzheimer disease
pdic05012
Parkinson disease
pdic05014
Amyotrophic lateral sclerosis
pdic05016
Huntington disease
pdic05017
Spinocerebellar ataxia
pdic05020
Prion disease
pdic05022
Pathways of neurodegeneration - multiple diseases
pdic05169
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:
pdic00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
114488197 (PSMD7)
09160 Human Diseases
09172 Infectious disease: viral
05169 Epstein-Barr virus infection
114488197 (PSMD7)
09164 Neurodegenerative disease
05010 Alzheimer disease
114488197 (PSMD7)
05012 Parkinson disease
114488197 (PSMD7)
05014 Amyotrophic lateral sclerosis
114488197 (PSMD7)
05016 Huntington disease
114488197 (PSMD7)
05017 Spinocerebellar ataxia
114488197 (PSMD7)
05020 Prion disease
114488197 (PSMD7)
05022 Pathways of neurodegeneration - multiple diseases
114488197 (PSMD7)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
pdic03051
]
114488197 (PSMD7)
Proteasome [BR:
pdic03051
]
Eukaryotic proteasome
Regulatory particles
PA700 (19S proteasome)
non-ATPase subunits
114488197 (PSMD7)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
MitMem_reg
JAB
Connexin
Motif
Other DBs
NCBI-GeneID:
114488197
NCBI-ProteinID:
XP_028357670
UniProt:
A0A6J2KWL8
LinkDB
All DBs
Position
12:complement(62189657..62198487)
Genome browser
AA seq
322 aa
AA seq
DB search
MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDE
DDKDDSVWFLDHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSV
LVIIDVKPKDLGLPTEAYISVEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIK
DTTVGTLSQRITNQVHGLKGLNSKLLDIRSYLEKVATGKLPINHQIIYQLQDVFNLLPDV
SLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKIANRDAEKKEGQEKEESKKDR
KDDKEKDKEKSDVKKEEKKEKK
NT seq
969 nt
NT seq
+upstream
nt +downstream
nt
atgccggagctggcggtgcagaaggtggtggtccaccccctggtgctgctcagtgtggtg
gatcatttcaaccgaataggcaaggttggaaaccagaagcgtgttgttggtgtgcttttg
gggtcatggcaaaagaaagtacttgatgtatccaacagttttgcagtcccttttgatgaa
gatgacaaagatgattctgtctggtttttagaccatgattacctggaaaacatgtatgga
atgtttaagaaggtcaatgccagggaaagaatagttgggtggtaccacacaggccctaaa
ttacataagaatgacatcgccatcaatgaactcatgaaaagatactgccctaactcagta
ttagtcatcatcgacgtgaagccaaaggacctgggactgcccacagaagcatatatttca
gtggaagaagttcatgatgatggaaccccaacctcaaaaacatttgagcatgtgaccagt
gaaattggagcagaggaagctgaagaagttggagtcgaacacttgttacgagacatcaaa
gacactaccgtgggcactctttcccagcgaatcacaaaccaggtgcatggtttgaaggga
ctgaactccaagcttctggatatcaggagctacctggagaaagtggccacaggcaagctg
cccatcaaccaccagatcatctaccagctgcaagatgtcttcaacctgctgccagatgtc
agcctgcaggagtttgtcaaggccttttacctaaagaccaatgaccagatggttgtggtg
tatttggcttccctgatccgttctgtggtcgccctgcacaacctcatcaacaacaagatt
gccaaccgggatgcagagaagaaggaagggcaggaaaaagaagagagcaaaaaggataga
aaagatgacaaggagaaagataaggaaaagagtgatgtaaagaaagaagagaaaaaggag
aaaaaataa
DBGET
integrated database retrieval system