KEGG   Phyllostomus discolor (pale spear-nosed bat): 114496946
Entry
114496946         CDS       T07739                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pdic  Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic01521  EGFR tyrosine kinase inhibitor resistance
pdic01522  Endocrine resistance
pdic01524  Platinum drug resistance
pdic04010  MAPK signaling pathway
pdic04012  ErbB signaling pathway
pdic04014  Ras signaling pathway
pdic04015  Rap1 signaling pathway
pdic04022  cGMP-PKG signaling pathway
pdic04024  cAMP signaling pathway
pdic04062  Chemokine signaling pathway
pdic04066  HIF-1 signaling pathway
pdic04068  FoxO signaling pathway
pdic04071  Sphingolipid signaling pathway
pdic04072  Phospholipase D signaling pathway
pdic04114  Oocyte meiosis
pdic04140  Autophagy - animal
pdic04148  Efferocytosis
pdic04150  mTOR signaling pathway
pdic04151  PI3K-Akt signaling pathway
pdic04210  Apoptosis
pdic04218  Cellular senescence
pdic04261  Adrenergic signaling in cardiomyocytes
pdic04270  Vascular smooth muscle contraction
pdic04350  TGF-beta signaling pathway
pdic04360  Axon guidance
pdic04370  VEGF signaling pathway
pdic04371  Apelin signaling pathway
pdic04380  Osteoclast differentiation
pdic04510  Focal adhesion
pdic04520  Adherens junction
pdic04540  Gap junction
pdic04550  Signaling pathways regulating pluripotency of stem cells
pdic04611  Platelet activation
pdic04613  Neutrophil extracellular trap formation
pdic04620  Toll-like receptor signaling pathway
pdic04621  NOD-like receptor signaling pathway
pdic04625  C-type lectin receptor signaling pathway
pdic04650  Natural killer cell mediated cytotoxicity
pdic04657  IL-17 signaling pathway
pdic04658  Th1 and Th2 cell differentiation
pdic04659  Th17 cell differentiation
pdic04660  T cell receptor signaling pathway
pdic04662  B cell receptor signaling pathway
pdic04664  Fc epsilon RI signaling pathway
pdic04666  Fc gamma R-mediated phagocytosis
pdic04668  TNF signaling pathway
pdic04713  Circadian entrainment
pdic04720  Long-term potentiation
pdic04722  Neurotrophin signaling pathway
pdic04723  Retrograde endocannabinoid signaling
pdic04724  Glutamatergic synapse
pdic04725  Cholinergic synapse
pdic04726  Serotonergic synapse
pdic04730  Long-term depression
pdic04810  Regulation of actin cytoskeleton
pdic04910  Insulin signaling pathway
pdic04912  GnRH signaling pathway
pdic04914  Progesterone-mediated oocyte maturation
pdic04915  Estrogen signaling pathway
pdic04916  Melanogenesis
pdic04917  Prolactin signaling pathway
pdic04919  Thyroid hormone signaling pathway
pdic04921  Oxytocin signaling pathway
pdic04926  Relaxin signaling pathway
pdic04928  Parathyroid hormone synthesis, secretion and action
pdic04929  GnRH secretion
pdic04930  Type II diabetes mellitus
pdic04933  AGE-RAGE signaling pathway in diabetic complications
pdic04934  Cushing syndrome
pdic04935  Growth hormone synthesis, secretion and action
pdic04960  Aldosterone-regulated sodium reabsorption
pdic05010  Alzheimer disease
pdic05020  Prion disease
pdic05022  Pathways of neurodegeneration - multiple diseases
pdic05034  Alcoholism
pdic05132  Salmonella infection
pdic05133  Pertussis
pdic05135  Yersinia infection
pdic05140  Leishmaniasis
pdic05142  Chagas disease
pdic05145  Toxoplasmosis
pdic05152  Tuberculosis
pdic05160  Hepatitis C
pdic05161  Hepatitis B
pdic05163  Human cytomegalovirus infection
pdic05164  Influenza A
pdic05165  Human papillomavirus infection
pdic05166  Human T-cell leukemia virus 1 infection
pdic05167  Kaposi sarcoma-associated herpesvirus infection
pdic05170  Human immunodeficiency virus 1 infection
pdic05171  Coronavirus disease - COVID-19
pdic05200  Pathways in cancer
pdic05203  Viral carcinogenesis
pdic05205  Proteoglycans in cancer
pdic05206  MicroRNAs in cancer
pdic05207  Chemical carcinogenesis - receptor activation
pdic05208  Chemical carcinogenesis - reactive oxygen species
pdic05210  Colorectal cancer
pdic05211  Renal cell carcinoma
pdic05212  Pancreatic cancer
pdic05213  Endometrial cancer
pdic05214  Glioma
pdic05215  Prostate cancer
pdic05216  Thyroid cancer
pdic05218  Melanoma
pdic05219  Bladder cancer
pdic05220  Chronic myeloid leukemia
pdic05221  Acute myeloid leukemia
pdic05223  Non-small cell lung cancer
pdic05224  Breast cancer
pdic05225  Hepatocellular carcinoma
pdic05226  Gastric cancer
pdic05230  Central carbon metabolism in cancer
pdic05231  Choline metabolism in cancer
pdic05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pdic05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pdic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114496946 (MAPK3)
   04012 ErbB signaling pathway
    114496946 (MAPK3)
   04014 Ras signaling pathway
    114496946 (MAPK3)
   04015 Rap1 signaling pathway
    114496946 (MAPK3)
   04350 TGF-beta signaling pathway
    114496946 (MAPK3)
   04370 VEGF signaling pathway
    114496946 (MAPK3)
   04371 Apelin signaling pathway
    114496946 (MAPK3)
   04668 TNF signaling pathway
    114496946 (MAPK3)
   04066 HIF-1 signaling pathway
    114496946 (MAPK3)
   04068 FoxO signaling pathway
    114496946 (MAPK3)
   04072 Phospholipase D signaling pathway
    114496946 (MAPK3)
   04071 Sphingolipid signaling pathway
    114496946 (MAPK3)
   04024 cAMP signaling pathway
    114496946 (MAPK3)
   04022 cGMP-PKG signaling pathway
    114496946 (MAPK3)
   04151 PI3K-Akt signaling pathway
    114496946 (MAPK3)
   04150 mTOR signaling pathway
    114496946 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114496946 (MAPK3)
   04148 Efferocytosis
    114496946 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    114496946 (MAPK3)
   04210 Apoptosis
    114496946 (MAPK3)
   04218 Cellular senescence
    114496946 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114496946 (MAPK3)
   04520 Adherens junction
    114496946 (MAPK3)
   04540 Gap junction
    114496946 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    114496946 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114496946 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    114496946 (MAPK3)
   04613 Neutrophil extracellular trap formation
    114496946 (MAPK3)
   04620 Toll-like receptor signaling pathway
    114496946 (MAPK3)
   04621 NOD-like receptor signaling pathway
    114496946 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    114496946 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    114496946 (MAPK3)
   04660 T cell receptor signaling pathway
    114496946 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    114496946 (MAPK3)
   04659 Th17 cell differentiation
    114496946 (MAPK3)
   04657 IL-17 signaling pathway
    114496946 (MAPK3)
   04662 B cell receptor signaling pathway
    114496946 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    114496946 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    114496946 (MAPK3)
   04062 Chemokine signaling pathway
    114496946 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114496946 (MAPK3)
   04929 GnRH secretion
    114496946 (MAPK3)
   04912 GnRH signaling pathway
    114496946 (MAPK3)
   04915 Estrogen signaling pathway
    114496946 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    114496946 (MAPK3)
   04917 Prolactin signaling pathway
    114496946 (MAPK3)
   04921 Oxytocin signaling pathway
    114496946 (MAPK3)
   04926 Relaxin signaling pathway
    114496946 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    114496946 (MAPK3)
   04919 Thyroid hormone signaling pathway
    114496946 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    114496946 (MAPK3)
   04916 Melanogenesis
    114496946 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114496946 (MAPK3)
   04270 Vascular smooth muscle contraction
    114496946 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    114496946 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    114496946 (MAPK3)
   04725 Cholinergic synapse
    114496946 (MAPK3)
   04726 Serotonergic synapse
    114496946 (MAPK3)
   04720 Long-term potentiation
    114496946 (MAPK3)
   04730 Long-term depression
    114496946 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    114496946 (MAPK3)
   04722 Neurotrophin signaling pathway
    114496946 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    114496946 (MAPK3)
   04380 Osteoclast differentiation
    114496946 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    114496946 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114496946 (MAPK3)
   05206 MicroRNAs in cancer
    114496946 (MAPK3)
   05205 Proteoglycans in cancer
    114496946 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    114496946 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    114496946 (MAPK3)
   05203 Viral carcinogenesis
    114496946 (MAPK3)
   05230 Central carbon metabolism in cancer
    114496946 (MAPK3)
   05231 Choline metabolism in cancer
    114496946 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114496946 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114496946 (MAPK3)
   05212 Pancreatic cancer
    114496946 (MAPK3)
   05225 Hepatocellular carcinoma
    114496946 (MAPK3)
   05226 Gastric cancer
    114496946 (MAPK3)
   05214 Glioma
    114496946 (MAPK3)
   05216 Thyroid cancer
    114496946 (MAPK3)
   05221 Acute myeloid leukemia
    114496946 (MAPK3)
   05220 Chronic myeloid leukemia
    114496946 (MAPK3)
   05218 Melanoma
    114496946 (MAPK3)
   05211 Renal cell carcinoma
    114496946 (MAPK3)
   05219 Bladder cancer
    114496946 (MAPK3)
   05215 Prostate cancer
    114496946 (MAPK3)
   05213 Endometrial cancer
    114496946 (MAPK3)
   05224 Breast cancer
    114496946 (MAPK3)
   05223 Non-small cell lung cancer
    114496946 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114496946 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    114496946 (MAPK3)
   05161 Hepatitis B
    114496946 (MAPK3)
   05160 Hepatitis C
    114496946 (MAPK3)
   05171 Coronavirus disease - COVID-19
    114496946 (MAPK3)
   05164 Influenza A
    114496946 (MAPK3)
   05163 Human cytomegalovirus infection
    114496946 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114496946 (MAPK3)
   05165 Human papillomavirus infection
    114496946 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114496946 (MAPK3)
   05135 Yersinia infection
    114496946 (MAPK3)
   05133 Pertussis
    114496946 (MAPK3)
   05152 Tuberculosis
    114496946 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    114496946 (MAPK3)
   05140 Leishmaniasis
    114496946 (MAPK3)
   05142 Chagas disease
    114496946 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114496946 (MAPK3)
   05020 Prion disease
    114496946 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    114496946 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    114496946 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114496946 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    114496946 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    114496946 (MAPK3)
   04934 Cushing syndrome
    114496946 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114496946 (MAPK3)
   01524 Platinum drug resistance
    114496946 (MAPK3)
   01522 Endocrine resistance
    114496946 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pdic01001]
    114496946 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pdic03036]
    114496946 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdic04147]
    114496946 (MAPK3)
Enzymes [BR:pdic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     114496946 (MAPK3)
Protein kinases [BR:pdic01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   114496946 (MAPK3)
Chromosome and associated proteins [BR:pdic03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     114496946 (MAPK3)
Exosome [BR:pdic04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   114496946 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 114496946
NCBI-ProteinID: XP_028368443
UniProt: A0A6J2LR87
LinkDB
Position
3:117880221..117887329
AA seq 379 aa
MAAAAAQGGGGGEPGGADGVGPGGPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHICKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGVLEAT
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcagcggcagctcaggggggcgggggcggggagcccggaggagcagatggggtc
ggcccggggggcccgggggaagtggagatagtgaaggggcagccgttcgacgtgggcccg
cgatacacgcagctgcagtacatcggcgagggcgcgtatggcatggtcagctcagcctac
gaccacatatgcaagacacgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacactgcgggaaatccagatcttgctgcgtttccgccacgagaatgtc
atcggcatccgagacattcttcgggcacctaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaac
gaccacgtctgctacttcctctaccagatcctgcggggcctcaagtatatccactcagcc
aacgtgctccaccgggatttaaagccctccaacctgctcatcaataccacctgcgacctt
aagatctgtgattttggcctggcccggattgctgatcctgagcatgaccacaccggcttc
ctgacagaatacgtggccacacgctggtaccgggccccagagatcatgcttaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatc
ctgggctccccgtcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtccctgccttccaagaccaaggtggcctgggccaagctttttcccaaatcagac
tccaaagcccttgacctgctggaccggatgttgacctttaaccccaataagcggatcaca
gtggaagaagccttggctcacccctacctggagcagtactatgacccaacagatgagccg
gtggctgaggaacctttcacctttgacatggagctggatgatctacccaaggagcggctg
aaggagctcatattccaggagacagcccgcttccagcctggggtgctggaggccacctaa

DBGET integrated database retrieval system