KEGG   Phyllostomus discolor (pale spear-nosed bat): 114499451
Entry
114499451         CDS       T07739                                 
Symbol
VEGFB
Name
(RefSeq) vascular endothelial growth factor B isoform X2
  KO
K16858  vascular endothelial growth factor B
Organism
pdic  Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic04010  MAPK signaling pathway
pdic04014  Ras signaling pathway
pdic04015  Rap1 signaling pathway
pdic04020  Calcium signaling pathway
pdic04151  PI3K-Akt signaling pathway
pdic04510  Focal adhesion
pdic04926  Relaxin signaling pathway
pdic04933  AGE-RAGE signaling pathway in diabetic complications
pdic05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pdic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114499451 (VEGFB)
   04014 Ras signaling pathway
    114499451 (VEGFB)
   04015 Rap1 signaling pathway
    114499451 (VEGFB)
   04020 Calcium signaling pathway
    114499451 (VEGFB)
   04151 PI3K-Akt signaling pathway
    114499451 (VEGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114499451 (VEGFB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    114499451 (VEGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114499451 (VEGFB)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    114499451 (VEGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:pdic04052]
    114499451 (VEGFB)
Cytokines and neuropeptides [BR:pdic04052]
 Cytokines
  Growth factors (RTK binding)
   114499451 (VEGFB)
SSDB
Motif
Pfam: PDGF CXCXC VEGF_C
Other DBs
NCBI-GeneID: 114499451
NCBI-ProteinID: XP_028371443
UniProt: A0A6J2M071
LinkDB
Position
6:164865816..164869335
AA seq 194 aa
MAPVGTMSPLLRRLLLAALLQLAPAQAPASLPEAPGHQKKVVSWIDVYARATCQPREVVV
PLTLELVGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEM
SLEEHSQCECRPKKKESAVKPDSPRPLCPRCPQRRQRPDPRTCHCRCRRRSFLRCQGRGL
ELNPDTCRCRKLRK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcccccgtgggcaccatgagccccttgctccgccgcctgctgctcgcggcgctcttg
cagctggcccccgcccaggcccccgcctccctgcctgaggcccctggccaccagaagaaa
gtggtgtcatggatagatgtgtatgctcgtgccacctgccagccacgggaggtggtagtg
cccctcactctggagcttgtgggcaccgtggccaagcagctggtacccagctgtgtgact
gtgcagcgctgcggcggctgctgccccgacgatggcctggagtgcgtgcctactgggcag
caccaagtccgaatgcagatcctcatgatccggtacccaagcagtcagctgggggaaatg
tccctggaagaacacagccagtgtgaatgcagaccaaaaaaaaaagagagtgccgtgaag
cccgacagccccaggcccctctgcccacgctgtccccagcgccgccagcgccctgacccc
aggacctgccactgccgctgcagacgccgcagcttcctccgttgccaagggcggggctta
gagctcaacccagacacctgcaggtgccggaagctgcgaaagtga

DBGET integrated database retrieval system