KEGG   Phyllostomus discolor (pale spear-nosed bat): 114499504
Entry
114499504         CDS       T07739                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X2
  KO
K02833  GTPase HRas
Organism
pdic  Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic01521  EGFR tyrosine kinase inhibitor resistance
pdic01522  Endocrine resistance
pdic04010  MAPK signaling pathway
pdic04012  ErbB signaling pathway
pdic04014  Ras signaling pathway
pdic04015  Rap1 signaling pathway
pdic04062  Chemokine signaling pathway
pdic04068  FoxO signaling pathway
pdic04071  Sphingolipid signaling pathway
pdic04072  Phospholipase D signaling pathway
pdic04137  Mitophagy - animal
pdic04140  Autophagy - animal
pdic04144  Endocytosis
pdic04150  mTOR signaling pathway
pdic04151  PI3K-Akt signaling pathway
pdic04210  Apoptosis
pdic04211  Longevity regulating pathway
pdic04213  Longevity regulating pathway - multiple species
pdic04218  Cellular senescence
pdic04360  Axon guidance
pdic04370  VEGF signaling pathway
pdic04371  Apelin signaling pathway
pdic04510  Focal adhesion
pdic04540  Gap junction
pdic04550  Signaling pathways regulating pluripotency of stem cells
pdic04625  C-type lectin receptor signaling pathway
pdic04630  JAK-STAT signaling pathway
pdic04650  Natural killer cell mediated cytotoxicity
pdic04660  T cell receptor signaling pathway
pdic04662  B cell receptor signaling pathway
pdic04664  Fc epsilon RI signaling pathway
pdic04714  Thermogenesis
pdic04720  Long-term potentiation
pdic04722  Neurotrophin signaling pathway
pdic04725  Cholinergic synapse
pdic04726  Serotonergic synapse
pdic04730  Long-term depression
pdic04810  Regulation of actin cytoskeleton
pdic04910  Insulin signaling pathway
pdic04912  GnRH signaling pathway
pdic04915  Estrogen signaling pathway
pdic04916  Melanogenesis
pdic04917  Prolactin signaling pathway
pdic04919  Thyroid hormone signaling pathway
pdic04921  Oxytocin signaling pathway
pdic04926  Relaxin signaling pathway
pdic04929  GnRH secretion
pdic04933  AGE-RAGE signaling pathway in diabetic complications
pdic04935  Growth hormone synthesis, secretion and action
pdic05010  Alzheimer disease
pdic05022  Pathways of neurodegeneration - multiple diseases
pdic05034  Alcoholism
pdic05132  Salmonella infection
pdic05160  Hepatitis C
pdic05161  Hepatitis B
pdic05163  Human cytomegalovirus infection
pdic05165  Human papillomavirus infection
pdic05166  Human T-cell leukemia virus 1 infection
pdic05167  Kaposi sarcoma-associated herpesvirus infection
pdic05170  Human immunodeficiency virus 1 infection
pdic05200  Pathways in cancer
pdic05203  Viral carcinogenesis
pdic05205  Proteoglycans in cancer
pdic05206  MicroRNAs in cancer
pdic05207  Chemical carcinogenesis - receptor activation
pdic05208  Chemical carcinogenesis - reactive oxygen species
pdic05210  Colorectal cancer
pdic05211  Renal cell carcinoma
pdic05213  Endometrial cancer
pdic05214  Glioma
pdic05215  Prostate cancer
pdic05216  Thyroid cancer
pdic05218  Melanoma
pdic05219  Bladder cancer
pdic05220  Chronic myeloid leukemia
pdic05221  Acute myeloid leukemia
pdic05223  Non-small cell lung cancer
pdic05224  Breast cancer
pdic05225  Hepatocellular carcinoma
pdic05226  Gastric cancer
pdic05230  Central carbon metabolism in cancer
pdic05231  Choline metabolism in cancer
pdic05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pdic05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pdic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114499504 (HRAS)
   04012 ErbB signaling pathway
    114499504 (HRAS)
   04014 Ras signaling pathway
    114499504 (HRAS)
   04015 Rap1 signaling pathway
    114499504 (HRAS)
   04370 VEGF signaling pathway
    114499504 (HRAS)
   04371 Apelin signaling pathway
    114499504 (HRAS)
   04630 JAK-STAT signaling pathway
    114499504 (HRAS)
   04068 FoxO signaling pathway
    114499504 (HRAS)
   04072 Phospholipase D signaling pathway
    114499504 (HRAS)
   04071 Sphingolipid signaling pathway
    114499504 (HRAS)
   04151 PI3K-Akt signaling pathway
    114499504 (HRAS)
   04150 mTOR signaling pathway
    114499504 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114499504 (HRAS)
   04140 Autophagy - animal
    114499504 (HRAS)
   04137 Mitophagy - animal
    114499504 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    114499504 (HRAS)
   04218 Cellular senescence
    114499504 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114499504 (HRAS)
   04540 Gap junction
    114499504 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    114499504 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114499504 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114499504 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    114499504 (HRAS)
   04660 T cell receptor signaling pathway
    114499504 (HRAS)
   04662 B cell receptor signaling pathway
    114499504 (HRAS)
   04664 Fc epsilon RI signaling pathway
    114499504 (HRAS)
   04062 Chemokine signaling pathway
    114499504 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114499504 (HRAS)
   04929 GnRH secretion
    114499504 (HRAS)
   04912 GnRH signaling pathway
    114499504 (HRAS)
   04915 Estrogen signaling pathway
    114499504 (HRAS)
   04917 Prolactin signaling pathway
    114499504 (HRAS)
   04921 Oxytocin signaling pathway
    114499504 (HRAS)
   04926 Relaxin signaling pathway
    114499504 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    114499504 (HRAS)
   04919 Thyroid hormone signaling pathway
    114499504 (HRAS)
   04916 Melanogenesis
    114499504 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    114499504 (HRAS)
   04726 Serotonergic synapse
    114499504 (HRAS)
   04720 Long-term potentiation
    114499504 (HRAS)
   04730 Long-term depression
    114499504 (HRAS)
   04722 Neurotrophin signaling pathway
    114499504 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    114499504 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    114499504 (HRAS)
   04213 Longevity regulating pathway - multiple species
    114499504 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    114499504 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114499504 (HRAS)
   05206 MicroRNAs in cancer
    114499504 (HRAS)
   05205 Proteoglycans in cancer
    114499504 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    114499504 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    114499504 (HRAS)
   05203 Viral carcinogenesis
    114499504 (HRAS)
   05230 Central carbon metabolism in cancer
    114499504 (HRAS)
   05231 Choline metabolism in cancer
    114499504 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    114499504 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114499504 (HRAS)
   05225 Hepatocellular carcinoma
    114499504 (HRAS)
   05226 Gastric cancer
    114499504 (HRAS)
   05214 Glioma
    114499504 (HRAS)
   05216 Thyroid cancer
    114499504 (HRAS)
   05221 Acute myeloid leukemia
    114499504 (HRAS)
   05220 Chronic myeloid leukemia
    114499504 (HRAS)
   05218 Melanoma
    114499504 (HRAS)
   05211 Renal cell carcinoma
    114499504 (HRAS)
   05219 Bladder cancer
    114499504 (HRAS)
   05215 Prostate cancer
    114499504 (HRAS)
   05213 Endometrial cancer
    114499504 (HRAS)
   05224 Breast cancer
    114499504 (HRAS)
   05223 Non-small cell lung cancer
    114499504 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114499504 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    114499504 (HRAS)
   05161 Hepatitis B
    114499504 (HRAS)
   05160 Hepatitis C
    114499504 (HRAS)
   05163 Human cytomegalovirus infection
    114499504 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    114499504 (HRAS)
   05165 Human papillomavirus infection
    114499504 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    114499504 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114499504 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    114499504 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    114499504 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114499504 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    114499504 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114499504 (HRAS)
   01522 Endocrine resistance
    114499504 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdic04131]
    114499504 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdic04147]
    114499504 (HRAS)
   04031 GTP-binding proteins [BR:pdic04031]
    114499504 (HRAS)
Membrane trafficking [BR:pdic04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    114499504 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    114499504 (HRAS)
Exosome [BR:pdic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   114499504 (HRAS)
  Exosomal proteins of colorectal cancer cells
   114499504 (HRAS)
GTP-binding proteins [BR:pdic04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    114499504 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N nSTAND3 CdhD
Other DBs
NCBI-GeneID: 114499504
NCBI-ProteinID: XP_028371530
UniProt: A0A6J2LZW4
LinkDB
Position
6:171308200..171311171
AA seq 170 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTLWDPPGPP
NT seq 513 nt   +upstreamnt  +downstreamnt
atgacggagtataagctcgtggtggtgggtgctgggggcgtggggaagagcgccctgacc
atccagctcatccagaaccacttcgtggacgagtatgaccccaccatcgaggactcctac
cggaagcaggtggtcatcgacggggagacgtgtctgctggacatcctggacacggcgggc
caggaggagtacagcgccatgcgggaccagtacatgcgcaccggcgagggcttcctctgc
gtgtttgccatcaacaacaccaagtccttcgaggacattcaccagtaccgggagcagatc
aagagggtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgacctg
gccgcccgcacggtggagtctcggcaggcacaggacctcgcccgcagctacggcatcccc
tacatcgagacctcggccaagacgcgccagggcagccgctctggctctggctccagctcc
gggaccctctgggaccctccgggacccccgtga

DBGET integrated database retrieval system