Phyllostomus discolor (pale spear-nosed bat): 114501014
Help
Entry
114501014 CDS
T07739
Symbol
PFN4
Name
(RefSeq) profilin-4 isoform X2
KO
K05759
profilin
Organism
pdic
Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic04015
Rap1 signaling pathway
pdic04810
Regulation of actin cytoskeleton
pdic05014
Amyotrophic lateral sclerosis
pdic05132
Salmonella infection
Brite
KEGG Orthology (KO) [BR:
pdic00001
]
09130 Environmental Information Processing
09132 Signal transduction
04015 Rap1 signaling pathway
114501014 (PFN4)
09140 Cellular Processes
09142 Cell motility
04810 Regulation of actin cytoskeleton
114501014 (PFN4)
09160 Human Diseases
09171 Infectious disease: bacterial
05132 Salmonella infection
114501014 (PFN4)
09164 Neurodegenerative disease
05014 Amyotrophic lateral sclerosis
114501014 (PFN4)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
pdic04131
]
114501014 (PFN4)
09183 Protein families: signaling and cellular processes
04812 Cytoskeleton proteins [BR:
pdic04812
]
114501014 (PFN4)
04147 Exosome [BR:
pdic04147
]
114501014 (PFN4)
Membrane trafficking [BR:
pdic04131
]
Others
Actin-binding proteins
Others
114501014 (PFN4)
Cytoskeleton proteins [BR:
pdic04812
]
Eukaryotic cytoskeleton proteins
Actin filaments / Microfilaments
Actin-binding proteins
Profilin
114501014 (PFN4)
Exosome [BR:
pdic04147
]
Exosomal proteins
Proteins found in most exosomes
114501014 (PFN4)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Profilin
Motif
Other DBs
NCBI-GeneID:
114501014
NCBI-ProteinID:
XP_028373553
UniProt:
A0A6J2M649
LinkDB
All DBs
Position
6:complement(22193034..22197719)
Genome browser
AA seq
129 aa
AA seq
DB search
MSHLQNLLLDSLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQAR
REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHLYLLVATYTEGMYPSVCVEATEKL
GEYLRKKGN
NT seq
390 nt
NT seq
+upstream
nt +downstream
nt
atgagccacttgcagaacttactgctcgattccctcctgggcacgaagcacgtggacagc
gcagccctcatcaagctccaggagcggagcctgtctgtagcatcaccagggttcagcgta
atgcccagtgacgtccgaacacttgtgaatgggttcgccaagaaccctttgcaagccaga
agagaaggactgtatttcaaggaaaaggactacaaatgcgtccgggcagacgattattct
ctttatgctaagaacgaaaacactggtgtgattgttgtgaagacccacctgtatcttctg
gtggcaacttacacagagggcatgtaccctagtgtctgcgtggaggccacagagaagctg
ggagaatatctaagaaaaaagggaaattaa
DBGET
integrated database retrieval system