KEGG   Phyllostomus discolor (pale spear-nosed bat): 114511679
Entry
114511679         CDS       T07739                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
pdic  Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic04610  Complement and coagulation cascades
pdic04810  Regulation of actin cytoskeleton
pdic05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:pdic00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114511679 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    114511679 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    114511679 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pdic04515]
    114511679 (ITGAX)
   04090 CD molecules [BR:pdic04090]
    114511679 (ITGAX)
Cell adhesion molecules [BR:pdic04515]
 Integrins
  Integrin alpha subunits
   114511679 (ITGAX)
CD molecules [BR:pdic04090]
 Proteins
  114511679 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 VWA_CoxE Integrin_alpha
Other DBs
NCBI-GeneID: 114511679
NCBI-ProteinID: XP_035875990
EnsemblRapid: ENSPDIG00005002525
UniProt: A0A7E6D9N1
LinkDB
Position
3:119157324..119186614
AA seq 1168 aa
MWEEWILVVKNTGVSSGKSDSLASSLCFNLDTDKPTTFLMDSAGXGHSVVQYANSWVVVG
APQEIKALNQTGGLYQCAYSTATCQPIDLQVPPEAVNMSLGLSLTAATNPSQLLACGPTV
HHACKENMYLTGFCFLLASPSWKAQRLPAALQECPRQEQDIVFLIDGSGSISSTNFVKML
SFVEAVMRQFQRPSTQFSLTQFSSNFWDHFTFKDFMYTSDPLSLLKSVHQLGGFTHTATA
IRRVINRQFSAQSGARKDASKILIVITDGEKKGDPLGYQDVIPMAEAAGIIRYAIGVGSA
FQKKHSWKELNDIASRPSSEYIFKVENFDALRDIQNKLKEKIFAIEGTQTISSRTFELEM
SQEGFSAVFTPDGPVLGAVGSFSWSGGAFVYPPNVSPTFINMSQENVDMRDSYLGYSIEL
ALWKGVQSLVLGAPRHQHTGKVVIFTQMSRKWRPMAEVTGTQIGSYFGASLCSVDMDRDG
SSDLVLIGAPHYYEPTRGGQVSVCSLPRGRARWQCEGILRGEQGHPWGRFGTALTVLGDV
NGDKLADVAIGAPGEQENQGAVYLFHGTSGLGISPSHSQRITGSQFSPRLQHFGQSLSGG
QDLTLDGLVDLAVGAQGRALLLRTRPVLRVWVNVYITPAEIARSVYECQEHTSSVQELGD
ANVCLHIYERPKNQLGDLQSTVTLHLTLDPGHVNPRAIFKETRNRSLTHVRVLGLGQHCE
DVKLLLLACVEDSVTPISLGLNFSLVGNPISSFGDLQPMLATDVPRYYTASLPFEKNCGA
DHVCQDDLGISFGFSGLKTLVVGSNLELNMEVKVWNEGEDSYGTTVTFSYPAGLSFRRVA
ESQCQLQSRSLHLTCDSAPARGQDSWSTHCSIKHLIFREGAQINFIATFDVSPKAMLGDR
LLLMANVSSENNTPRTSKTTFQQELPVKYAVYTVISSHEESTKYLNFSASEEQGSSLAQH
RYQVNNLGQRDLPVSISFLVPVELNQVTVWTGLKILHPQNPSIQCSAERTVPTESNFLTH
IQKNHVLDCSIAECLRFRCDIPSFGIQEELDFILKGNLSFSWVSQTLQKKVSVVSVAEIT
FSRSVYSQLPGQEAFLRAQMEMVLEEYEVYDPIPLIVGSSVGGLLLLALITATLYKLGFF
KRQYKEMLDDKPEDTATFSGDTPNLPLS
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgtgggaagaatggattctggtggtcaaaaatacaggtgtttccagtgggaagtctgac
agcctggcttcctctctctgcttcaacttggacacagacaagccaacaaccttcctcatg
gacagtgctgggnttggacacagtgtggtccagtatgccaactcctgggtggtagttgga
gccccccaggaaataaaggctctcaaccaaacaggaggcctctaccagtgtgcctatagc
acagccacctgtcagcccattgacctgcaggtccccccagaagctgtgaacatgtccctg
ggcctatccctgacagctgccaccaacccctctcagctgctggcctgtggccccactgtg
caccatgcatgcaaggagaacatgtacttgaccgggttctgctttctgttggcctcccct
tcctggaaggcccagaggctcccagctgccctgcaggagtgcccaaggcaggagcaggac
atcgtctttctgattgatggctctggcagcatttcttctacaaattttgtcaagatgctg
agcttcgtggaggctgtgatgagacagttccagagacccagcacccagttctccctgacg
cagttctccagcaacttctgggatcacttcactttcaaagacttcatgtacacctcagac
ccactaagcctgctgaagtctgtgcatcagctgggagggttcacgcacacagccacagcc
atcaggagggtcataaatagacaattcagtgcccaaagtggggcccgaaaggatgcctcc
aagatcctcattgtcatcactgatggagagaaaaaaggagaccccctgggttatcaggat
gtcatccctatggctgaggcagcaggcatcattcgctatgcaattggggttggatccgcg
tttcaaaagaaacattcctggaaagaattaaatgacattgcatcaaggccctccagtgaa
tatatatttaaagtggagaactttgatgctttgagagacatccaaaacaaactaaaagag
aagatctttgccattgagggaacacagacaataagcagtaggaccttcgaattggagatg
tcccaggagggcttcagtgctgtgtttacacccgatggaccagttctgggggctgtgggg
agcttcagctggtctggaggtgcctttgtgtaccccccgaatgtgagccccacattcatc
aacatgtctcaggagaatgtggacatgagggactcttacctgggttactccattgagctg
gccctttggaagggggtgcagagcttggtcctgggggctccccgacatcagcacaccggg
aaggttgtcatctttacccagatgtccaggaaatggaggccaatggctgaagtcacaggg
acccagattggctcttactttggggcctccctgtgctccgtggacatggacagagatggc
agctctgacctggtcctcattggggctccccattactacgagccgacccgggggggccag
gtgtctgtgtgctccttgcctcgggggagagctaggtggcagtgtgagggcattctccgt
ggggagcagggccacccctggggtcgcttcgggacagctctgactgtgctgggggacgtg
aatggggacaagctggcagatgtggccatcggggccccgggagaacaggagaaccaggga
gctgtctacctgtttcatgggacctcaggactgggcatcagcccctcccacagccagagg
atcacgggatcccagttctcccccagactccagcattttggacagtcactgagtggcggt
caagatctcaccctagatggacttgtggacctggccgtgggggcccaggggcgtgcactg
ctgctcaggaccagacctgtgctgagggtgtgggtcaatgtctacataacacctgcagag
attgctaggtctgtgtatgagtgtcaggagcacacgtcctctgtccaggaactgggtgat
gccaatgtctgccttcacatttatgaacgtcccaagaaccagctgggtgacctccaaagc
accgtgacccttcacttgaccctggaccctggtcatgtgaatccccgtgccattttcaag
gagacaagaaatcggagtctcactcatgtcagagttcttgggctgggacagcattgtgag
gatgtgaagttgctccttctggcttgtgtggaagactcagtgacccccatcagcttgggt
ctcaatttctccctggtgggcaaccccatctcttcctttggagacctccagcctatgctg
gctacggatgtccccagatactacacggcctctctcccctttgagaagaactgcggagct
gaccacgtctgccaagatgacctgggcatctcttttggtttctcaggcttgaagaccctg
gtggtggggagtaacctagagctgaacatggaagtgaaagtgtggaatgaaggggaggac
tcctatggaaccacagtcaccttctcctacccagcggggctgtcttttcgacgtgtggca
gagagccagtgccagctgcagtcacgctccctgcacctgacctgtgacagcgccccagcc
agaggccaggacagctggagcacccactgcagcatcaaacaccttatcttccgtgagggg
gctcagatcaacttcatagccacctttgacgtctcccccaaggccatgctgggagaccgc
ctgcttctaatggccaatgtgagcagtgagaataacacccccaggaccagcaagaccacc
ttccagcaggagctcccagtgaagtatgctgtctacaccgtgatcagcagccatgaggag
tccaccaagtacctcaacttctctgcctctgaggagcagggaagcagcctggcccagcac
agataccaggtgaacaacctgggacagagggacctgcctgtcagcatcagcttcttggtg
cctgtggagctgaaccaggtgactgtgtggacagggctgaagatcctccacccccagaac
ccatctattcagtgttctgcagagagaacggtgcccacggagtccaacttcctcacccac
attcagaagaatcatgtgctggactgctccattgctgagtgtctgaggttccgctgtgac
atcccctccttcggcatccaggaggagcttgacttcatcctgaagggcaacctcagcttc
agctgggtcagccagacattgcagaagaaggtatcggtcgtgagtgtggctgaaatcacg
ttcagcagatctgtgtattcccagcttccaggacaggaggcgtttctgagagcccagatg
gagatggtgctagaggagtatgaagtttatgatcccatccccctcattgtgggcagctct
gtgggaggactgctgctgctggctctcatcacagcaacactctacaagcttggattcttc
aaacgtcagtacaaagaaatgctggatgacaagcctgaagacactgccacattcagcggg
gacaccccaaatttgcctttgtcctaa

DBGET integrated database retrieval system