KEGG   Phyllostomus discolor (pale spear-nosed bat): 114513363
Entry
114513363         CDS       T07739                                 
Name
(RefSeq) calmodulin-1-like
  KO
K02183  calmodulin
Organism
pdic  Phyllostomus discolor (pale spear-nosed bat)
Pathway
pdic04014  Ras signaling pathway
pdic04015  Rap1 signaling pathway
pdic04020  Calcium signaling pathway
pdic04022  cGMP-PKG signaling pathway
pdic04024  cAMP signaling pathway
pdic04070  Phosphatidylinositol signaling system
pdic04114  Oocyte meiosis
pdic04218  Cellular senescence
pdic04261  Adrenergic signaling in cardiomyocytes
pdic04270  Vascular smooth muscle contraction
pdic04371  Apelin signaling pathway
pdic04625  C-type lectin receptor signaling pathway
pdic04713  Circadian entrainment
pdic04720  Long-term potentiation
pdic04722  Neurotrophin signaling pathway
pdic04728  Dopaminergic synapse
pdic04740  Olfactory transduction
pdic04744  Phototransduction
pdic04750  Inflammatory mediator regulation of TRP channels
pdic04910  Insulin signaling pathway
pdic04912  GnRH signaling pathway
pdic04915  Estrogen signaling pathway
pdic04916  Melanogenesis
pdic04921  Oxytocin signaling pathway
pdic04922  Glucagon signaling pathway
pdic04924  Renin secretion
pdic04925  Aldosterone synthesis and secretion
pdic04970  Salivary secretion
pdic04971  Gastric acid secretion
pdic05010  Alzheimer disease
pdic05012  Parkinson disease
pdic05022  Pathways of neurodegeneration - multiple diseases
pdic05031  Amphetamine addiction
pdic05034  Alcoholism
pdic05133  Pertussis
pdic05152  Tuberculosis
pdic05163  Human cytomegalovirus infection
pdic05167  Kaposi sarcoma-associated herpesvirus infection
pdic05170  Human immunodeficiency virus 1 infection
pdic05200  Pathways in cancer
pdic05214  Glioma
pdic05417  Lipid and atherosclerosis
pdic05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pdic00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    114513363
   04015 Rap1 signaling pathway
    114513363
   04371 Apelin signaling pathway
    114513363
   04020 Calcium signaling pathway
    114513363
   04070 Phosphatidylinositol signaling system
    114513363
   04024 cAMP signaling pathway
    114513363
   04022 cGMP-PKG signaling pathway
    114513363
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    114513363
   04218 Cellular senescence
    114513363
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    114513363
  09152 Endocrine system
   04910 Insulin signaling pathway
    114513363
   04922 Glucagon signaling pathway
    114513363
   04912 GnRH signaling pathway
    114513363
   04915 Estrogen signaling pathway
    114513363
   04921 Oxytocin signaling pathway
    114513363
   04916 Melanogenesis
    114513363
   04924 Renin secretion
    114513363
   04925 Aldosterone synthesis and secretion
    114513363
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114513363
   04270 Vascular smooth muscle contraction
    114513363
  09154 Digestive system
   04970 Salivary secretion
    114513363
   04971 Gastric acid secretion
    114513363
  09156 Nervous system
   04728 Dopaminergic synapse
    114513363
   04720 Long-term potentiation
    114513363
   04722 Neurotrophin signaling pathway
    114513363
  09157 Sensory system
   04744 Phototransduction
    114513363
   04740 Olfactory transduction
    114513363
   04750 Inflammatory mediator regulation of TRP channels
    114513363
  09159 Environmental adaptation
   04713 Circadian entrainment
    114513363
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114513363
  09162 Cancer: specific types
   05214 Glioma
    114513363
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    114513363
   05163 Human cytomegalovirus infection
    114513363
   05167 Kaposi sarcoma-associated herpesvirus infection
    114513363
  09171 Infectious disease: bacterial
   05133 Pertussis
    114513363
   05152 Tuberculosis
    114513363
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114513363
   05012 Parkinson disease
    114513363
   05022 Pathways of neurodegeneration - multiple diseases
    114513363
  09165 Substance dependence
   05031 Amphetamine addiction
    114513363
   05034 Alcoholism
    114513363
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    114513363
   05418 Fluid shear stress and atherosclerosis
    114513363
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pdic01009]
    114513363
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pdic04131]
    114513363
   03036 Chromosome and associated proteins [BR:pdic03036]
    114513363
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdic04147]
    114513363
Protein phosphatases and associated proteins [BR:pdic01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     114513363
Membrane trafficking [BR:pdic04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    114513363
Chromosome and associated proteins [BR:pdic03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     114513363
Exosome [BR:pdic04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   114513363
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_FSTL1 AIF-1 EF-hand_9 EH EF_EFCAB10_C EFhand_Ca_insen EF-hand_EFHB_C CFAP251_C SPARC_Ca_bdg SAPC2_N BamM_C DUF1103 Dockerin_1 EF-hand_11 DUF5580_M EF-hand_STIM1 Lig_C FCaBP_EF-hand
Other DBs
NCBI-GeneID: 114513363
NCBI-ProteinID: XP_035874479
UniProt: A0A7E6D882
LinkDB
Position
2:complement(131244434..131245112)
AA seq 98 aa
MINDVDADGNGTIDFPEFLTTMERAMKDTDSEEEIREAFHVFDKDGNGYISAAELRHVMT
NLGEKLIDEEIEEMIREADIDGDGQVNYEEFVQMMTAK
NT seq 297 nt   +upstreamnt  +downstreamnt
atgattaatgatgtagatgctgatggtaatggcacaattgacttcccagaatttctgaca
acaatggaaagagcaatgaaagacacagacagtgaagaagaaattagagaagcattccat
gtgtttgataaggatggcaatggctacatcagtgcagcagagcttcgccatgtgatgaca
aaccttggagagaagttaatagatgaagagattgaggaaatgatcagggaagcagatatt
gatggtgatggtcaagtaaactatgaagagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system