Paraburkholderia dioscoreae: PDMSB3_3363 Help Entry PDMSB3_3363       CDS       T08115                                  Symbol acpP Name (GenBank) Acyl carrier protein 2   KO K02078   acyl carrier protein Organism pdio  Paraburkholderia dioscoreae Pathway pdio00998   Biosynthesis of various antibiotics pdio01100   Metabolic pathways pdio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PDMSB3_3363 (acpP)    00074 Mycolic acid biosynthesis     PDMSB3_3363 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PDMSB3_3363 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  VVD29819 UniProt:  A0A5Q4ZEJ8 LinkDB All DBs Position I:complement(3458622..3458873) Genome browser AA seq 83 aa AA seqDB search MSEAEILERIRAIFKENFAIEPERVTPEAHLFEDLDLDSIDAVDLAIKLQEMTGRRIKPE EFKSVRTVGDVIGAVESLLAAQG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgtccgaggcagagattctggagcgcatccgcgccatcttcaaagagaacttcgcgatc gagcccgagcgtgtcacgcccgaagcgcatctgttcgaagacctcgatctcgacagcatc gacgccgtcgacctcgcgatcaaactgcaggaaatgaccggacgccgcatcaagccggaa gagttcaagtcggtgcgcactgtcggcgacgtgatcggggcggtcgaatccctgctggcg gcacaaggctga

DBGET integrated database retrieval system