KEGG   Pantoea dispersa: KFZ74_01425
Entry
KFZ74_01425       CDS       T10176                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
pdip  Pantoea dispersa
Pathway
pdip00430  Taurine and hypotaurine metabolism
pdip00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:pdip00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    KFZ74_01425 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KFZ74_01425 (tauD)
Enzymes [BR:pdip01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     KFZ74_01425 (tauD)
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: UKY36812
LinkDB
Position
323827..324666
AA seq 279 aa
MNERVNFTALGPYIGAQVSDVDLSRPLSDAQFEQLYHGLLRHQVLFLRDQRITPEQQRAL
AIRFGDLHIHPVYPHAEGVEEIIVLDTHQDNPPDNDNWHTDVTFIQTPPAIAILASKLLP
ESGGDTLWTSGIAAYEALSEPFKQLLSGLQAEHDFKKSFQEYKYRKTEEEHQRWQQAVAK
HPPVQHPVIRTHPVSGRKALFVNEGFTTRLLGVSEKESEALLGYLFAHATKPEFQVRWRW
QPNDVAIWDNRVTQHYANADYYPARRVMHRATVLGDVPV
NT seq 840 nt   +upstreamnt  +downstreamnt
atgaacgaacgagtgaattttaccgcgctgggtccgtatatcggggcgcaggtcagcgat
gtcgatctcagccgtccgctgagtgacgcgcagtttgagcagctttaccatggtctgttg
cgtcaccaggtgctgtttctgcgcgatcagcgcattacgccggagcagcagcgcgcgctg
gcgatccgcttcggcgatctgcacattcatccggtttatccgcatgccgaaggcgtggaa
gagattatcgtgctggatacgcatcaggataatccgccggacaacgataactggcatacc
gacgtcacctttattcagacgccgccggcgatcgccattctggcctcaaagctgctgccg
gagagcggcggcgatacgctgtggaccagcggaattgccgcttacgaggcgctgtcagag
ccgttcaaacagctgctgagtggcctgcaggcggagcacgactttaagaaatcgttccag
gagtataagtaccgtaagacggaagaggagcatcagcgctggcagcaggccgtggcgaag
catccgccggtgcagcatccggtgatccgcacccatccggtgagtggacgcaaggcgctg
tttgttaatgaaggttttaccaccaggctgctgggcgtaagcgagaaggagagcgaggcg
ctgctgggctatctgtttgcgcacgccaccaagccggagtttcaggtgcgctggcgctgg
cagccgaatgacgtggcaatctgggataaccgcgtgacgcagcattatgccaacgcggat
tattatccggcgcggcgcgtgatgcatcgcgcgacggtgttaggggatgtgccggtgtga

DBGET integrated database retrieval system