Pantoea dispersa: KFZ74_20655 Help Entry KFZ74_20655       CDS       T10176                                  Name (GenBank) hypothetical protein   KO K02317   DNA replication protein DnaT Organism pdip  Pantoea dispersa Pathway pdip03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pdip00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     KFZ74_20655  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pdip03400]     KFZ74_20655 DNA repair and recombination proteins [BR:pdip03400]  Prokaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     RecBC pathway proteins      KFZ74_20655 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DnaT PHTF1-2_N Motif Other DBs NCBI-ProteinID:  UKY39018 LinkDB All DBs Position unnamed:111740..112021 Genome browser AA seq 93 aa AA seqDB search MFDGWQPSATFSDTANRIDIKISAAPDRLQLADFVNYWKAESVAYYQSQWELKLARYIEK GRKHLSSKRSRERRDCMLVSGMDYEIPEGFRGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtttgacgggtggcagccttcagcaacgtttagtgacaccgccaatcgtatagatatt aagatttcagctgcacctgacaggctgcagctggctgatttcgtgaattactggaaagca gaaagcgtggcgtactaccagagtcagtgggaattgaaactggcacgctatattgaaaag gggcgcaaacacctttcctctaagcgctccagagaaagacgagactgcatgctggtatct gggatggattatgaaatacctgaagggttcaggggagggtag

DBGET integrated database retrieval system