Pantoea dispersa: KFZ74_21005
Help
Entry
KFZ74_21005 CDS
T10176
Name
(GenBank) alpha/beta hydrolase
Organism
pdip Pantoea dispersa
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Abhydrolase_1
Abhydrolase_6
Ndr
EHN
Motif
Other DBs
NCBI-ProteinID:
UKY39082
LinkDB
All DBs
Position
unnamed:185832..186746
Genome browser
AA seq
304 aa
AA seq
DB search
MSLPALDAAPRWSQPVDHLPQFNHAYATVAGVRLHYVSGGNAQGPVLVLLAGFPQSWFAW
RKVMAQLAADYFIIAPDLPGQGDSDKPASGYDTTSLAHSVQGLLQQLGVERYYLAAHDVG
AWVAWPLAMLHGDAISKLALLDAGIPGVTLPDALPATPDKAWKTWHFAFHLLPDLPEALI
AGREALYLQWFLQRKAASPMVFGDEEMAEYVRLLQQNGALRAGMAAYREVSTSAEQNRQL
LQTRGKLAIPLLAVSADQGSIADMAQPLRTFAADVSGIRLAHCGHFIPDEQPQALADALR
QFFV
NT seq
915 nt
NT seq
+upstream
nt +downstream
nt
atgtcactgcctgccctggacgccgcgccgcgctggtcacagcccgtcgatcacctgccg
caatttaaccatgcttacgccacggtcgcgggcgtgcggctgcactatgtcagcggcggc
aatgcgcagggaccagtgctggtactgctggcgggctttccgcagagctggtttgcctgg
cgtaaggtgatggcgcagctggcggcagactatttcatcattgcgccggatctgcccggc
cagggcgactccgacaagcctgccagcggttatgacaccacctcactggcgcacagcgtg
cagggattgttgcagcagttgggtgttgagcgttactacctggccgcgcatgacgtgggt
gcctgggttgcctggccgctggcgatgctgcacggtgatgccatcagcaaactggcgctg
ctggatgccggcattcccggagtgacgctgccggatgcgctgcctgcgacgccggacaaa
gcctggaaaacctggcactttgcttttcacctgttgccggatctgccggaagcgctgatc
gccggtcgtgaagcgctctatctgcagtggtttttgcagcgcaaagcagccagcccgatg
gtgtttggtgacgaagagatggcggaatatgtgcggctgctgcagcaaaacggcgcgctg
cgcgccggcatggcggcgtaccgtgaagtcagcacctcagcggagcagaatcgtcagttg
ttgcaaacccggggaaaactggcgatcccgctgctggcggtgagcgccgatcagggctca
attgccgatatggcacagccgctgcgcacttttgcggccgacgtcagcgggattcgcctc
gcgcactgtggtcactttatcccggatgagcaaccgcaggcgctggccgacgcgttacgt
cagttctttgtgtga
DBGET
integrated database retrieval system