Candidatus Pantoea soli: D8B20_02570 Help Entry D8B20_02570       CDS       T06714                                  Name (GenBank) DNA polymerase III subunit psi   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism pdis  Candidatus Pantoea soli Pathway pdis03030   DNA replication pdis03430   Mismatch repair pdis03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pdis00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     D8B20_02570    03430 Mismatch repair     D8B20_02570    03440 Homologous recombination     D8B20_02570  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pdis03032]     D8B20_02570    03400 DNA repair and recombination proteins [BR:pdis03400]     D8B20_02570 Enzymes [BR:pdis01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      D8B20_02570 DNA replication proteins [BR:pdis03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      D8B20_02570 DNA repair and recombination proteins [BR:pdis03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      D8B20_02570 SSDB OrthologParalogGFIT Motif Pfam:  DNA_III_psi Motif Other DBs NCBI-ProteinID:  QDY40855 UniProt:  A0A518X9H3 LinkDB All DBs Position 561522..561932 Genome browser AA seq 136 aa AA seqDB search MSTRRDWLLQQMGIMQYQLRRPRVLKGEIAVTLRPETRLVLVAEHAPDLQEPLVRDVLRT LAIQPAQVLTLTPEQLPMLPEQVDCAGWLLGVSSDHPFNGVILTSAVFNELISSGAAKRA LWQQMCNHDSHLFHHP NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgagtacaaggcgcgactggcttttgcagcaaatggggattatgcagtaccagctgcgg cgtccgcgggtgctgaaaggggagatcgcggtgacgctcaggccggagacgcgtctggtg ctggtggcagaacatgcaccggacctgcaggagccgctggtgcgtgatgtcctgcgcacg ctggcgatacagccggcacaggtgctgacgctgacgccggaacagctgccgatgctgcct gaacaggtggattgcgccggctggctgctgggcgtcagcagcgaccaccctttcaacggc gtcatccttaccagcgccgttttcaatgaactgatcagcagcggcgcggcgaaacgcgcg ctgtggcaacagatgtgtaaccatgacagccatctctttcatcacccctga

DBGET integrated database retrieval system