Candidatus Pantoea soli: D8B20_06775 Help Entry D8B20_06775       CDS       T06714                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism pdis  Candidatus Pantoea soli Brite KEGG Orthology (KO) [BR:pdis00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pdis03400]     D8B20_06775 DNA repair and recombination proteins [BR:pdis03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     D8B20_06775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Kelch_KLHDC2_KLHL20_DRC7 SPAN Motif Other DBs NCBI-ProteinID:  QDY41610 UniProt:  A0A518XBS3 LinkDB All DBs Position complement(1461942..1462187) Genome browser AA seq 81 aa AA seqDB search MRVEITVAKTQPLPAGALDALSAELTRRITRDFPDDNHHVHVRYAGGNQLNVFGGCKASR ERISDILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaaattaccgtagcaaagactcagcccctgcctgctggcgcgctggacgca ctcagcgccgagcttacgcgccgtatcacccgcgattttcctgatgataatcatcatgtc cacgtccgctatgcgggcggtaatcagctgaacgtgtttgggggctgtaaagcctcgcgc gaacgtatcagcgatattctgcaggagacatgggaaagcgcggatgactggtttatcacc gactga

DBGET integrated database retrieval system