Candidatus Pantoea soli: D8B20_06825 Help Entry D8B20_06825       CDS       T06714                                  Symbol flgM Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pdis  Candidatus Pantoea soli Pathway pdis02020   Two-component system pdis02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pdis00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     D8B20_06825 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     D8B20_06825 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pdis02035]     D8B20_06825 (flgM) Bacterial motility proteins [BR:pdis02035]  Flagellar system   Flagellar assembly proteins    Others     D8B20_06825 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF6285 Motif Other DBs NCBI-ProteinID:  QDY41620 UniProt:  A0A518XBS9 LinkDB All DBs Position complement(1470707..1471012) Genome browser AA seq 101 aa AA seqDB search MSIDRTQPLKAVSTVQTRDNNDNAGKVRQNSAPATSAPRQSGAEVTLSTAQAQLMQPGSK DINTARVEQLKTAIRNGELKMDTGKIADALIADTRAYLEGK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagcatcgacagaacgcaacccctgaaagcggtgagcactgtacagacccgtgacaac aacgacaatgccggcaaagtgcgtcagaacagcgcaccggccaccagcgcaccgcgtcag agcggcgctgaagtaacgttgagcaccgctcaggcgcagctgatgcagcctggcagcaaa gatatcaacacagcgcgcgtagagcagctgaagacggccattcgtaatggcgaactgaaa atggataccggtaagatcgccgatgcgctgatcgccgatacccgggcgtatttagagggt aaatga

DBGET integrated database retrieval system