KEGG   Candidatus Pantoea soli: D8B20_18305
Entry
D8B20_18305       CDS       T06714                                 
Symbol
gabP
Name
(GenBank) GABA permease
  KO
K11735  GABA permease
Organism
pdis  Candidatus Pantoea soli
Brite
KEGG Orthology (KO) [BR:pdis00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pdis02000]
    D8B20_18305 (gabP)
Transporters [BR:pdis02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   D8B20_18305 (gabP)
SSDB
Motif
Pfam: AA_permease AA_permease_2 Spore_permease
Other DBs
NCBI-ProteinID: QDY43884
UniProt: A0A518XI63
LinkDB
Position
unnamed1:complement(188775..190169)
AA seq 464 aa
MTAQNADVLAQSLKPRHVRMLSIAGVIGAGLFVGSGHAIAEAGPAVLLAYIAAGALVVLI
MRMLAEMAVASPDSGSFSTYADKSLGRWAGFTIGWLYWWFWVLVIPLEANAAGTILHAWF
PQIDVWVYTLAITAFLTLSNLFSVKNYGEFEFWFALLKVVAIVAFLVAGSLAVLGLMPGS
STHGISHLYDTQGFMPNGISAVLAAILTTMFSFMGTEIVTIAAAESSEPRKQITQATNSV
IWRIALFYLLSIFLVIALVPWNTPSLMKNGSYQTAMEMMNVPYARQIVDVVVLIAVCSCL
NSALYTASRMIYSLSRRQDAPAVVSRTTRSGTPWVAVLFSTAAAFLAVIANYLAPSAVFE
FLLASSGAIALLVYLVIAASHLVLRKKREARGETLTYRMWLFPGLTWATIVFIIGVLTSM
LFNQQHRSEIIATGLLTVLVLMASQIVQRKRAARKSARMVAVRS
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgactgctcagaatgccgatgtactggcacaaagcctcaaaccgcgccacgtgcgcatg
ctctcaatagcgggcgtgattggcgcgggtctgtttgtcgggtccggccatgccattgca
gaagcgggtccggccgtcttgctggcgtatattgctgccggcgccctggtggtcctgatc
atgcgcatgctggcagaaatggccgtggcttcgccggattccggctccttttcaacctac
gccgacaaatcgctcggccgctgggcgggttttaccatcggctggctctactggtggttc
tgggtgctggtgattccgctggaggccaacgccgccggcaccattctgcacgcctggttc
ccgcagattgacgtctgggtatatacactggcgatcaccgcctttctcaccctcagtaat
ctgttcagcgtcaaaaattacggtgaatttgagttctggtttgccctgctgaaagtggtc
gcgatcgtcgctttcctggtcgccggcagtctggcggtattaggattgatgccgggcagc
agcacgcacggcatttcacatctctatgacacgcaagggtttatgccgaatggtatcagc
gcggtgctggccgcgattctcactaccatgttctcgttcatgggaacggagattgtgacc
attgccgctgccgaatccagcgaaccgcgcaaacagattacccaggccactaactccgtg
atctggcgcatcgccctgttttatctgctgtccatcttcctggtgatcgcgctggtgccg
tggaacacgccatcgctgatgaaaaatggctcctatcagacagccatggaaatgatgaac
gtgccctatgcccgacagattgtggatgtggtggtgttgattgcggtttgcagctgtctc
aattcggcactctataccgcttcccgcatgatttactcgctgtcccgtcgtcaggatgca
ccggcggtggtgtcccgcaccacgcgcagcggcacgccgtgggtagcggtgctgttctct
actgcggcagcgtttctggcggtgattgccaactacctggcgcccagcgcggtatttgag
ttcctgctggcaagttccggtgccattgcgctgctggtgtacctggtgatcgctgcttca
catctggtgttacgcaaaaaacgcgaagcgcgcggcgagacgctcacctaccgcatgtgg
ctgtttcccggcctcacctgggcgacgatcgtgttcattatcggcgtgctgacctccatg
ctgttcaatcagcagcatcgctctgaaatcatcgctaccgggctgttaacggtgctggtg
ctgatggccagtcagattgtgcagcgcaagcgcgccgcgcgcaaaagcgccaggatggtg
gctgtccgttcctga

DBGET integrated database retrieval system