Pampinifervens diazotrophicum: IAE16_04605 Help Entry IAE16_04605       CDS       T11281                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pdiz  Pampinifervens diazotrophicum Pathway pdiz02024   Quorum sensing pdiz03018   RNA degradation Brite KEGG Orthology (KO) [BR:pdiz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     IAE16_04605 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     IAE16_04605 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pdiz03019]     IAE16_04605 (hfq)    03036 Chromosome and associated proteins [BR:pdiz03036]     IAE16_04605 (hfq) Messenger RNA biogenesis [BR:pdiz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      IAE16_04605 (hfq) Chromosome and associated proteins [BR:pdiz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     IAE16_04605 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq DUF5608 Hfq_1 Motif Other DBs NCBI-ProteinID:  WPM32963 LinkDB All DBs Position 792541..792750 Genome browser AA seq 69 aa AA seqDB search MFMEKNTNVQDEYIEDLKKKGATVTVFLTRGNRITGKVLDHDKYTLLLEVEGEPNLIYKH AISTIVQGG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgtttatggaaaagaacaccaatgtgcaagacgaatacatagaagaccttaagaagaaa ggggctactgtgacagtgttcctcacaagaggaaataggataacgggcaaggtacttgac cacgacaagtatactctcttgcttgaggtagaaggtgagcctaaccttatatataagcat gcaataagcaccatagttcaagggggttaa

DBGET integrated database retrieval system