Pseudomonas aeruginosa DK2: PADK2_09525 Help Entry PADK2_09525       CDS       T02161                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdk  Pseudomonas aeruginosa DK2 Pathway pdk01100   Metabolic pathways pdk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PADK2_09525 (acpP)    00074 Mycolic acid biosynthesis     PADK2_09525 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PADK2_09525 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH DUF1896 TerB Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFM64192 LinkDB All DBs Position 2064043..2064279 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEKA EKITTVQEAIDYIVAHQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgttaagaagatcgtcgctgaacaactcggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gtcgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgagaaagct gaaaagatcaccaccgttcaggaagccatcgactacatcgttgctcaccagcaataa

DBGET integrated database retrieval system