Pyrodictium delaneyi: Pyrde_1929 Help Entry Pyrde_1929        CDS       T04114                                  Name (GenBank) hypothetical protein   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism pdl  Pyrodictium delaneyi Pathway pdl00290   Valine, leucine and isoleucine biosynthesis pdl00650   Butanoate metabolism pdl00660   C5-Branched dibasic acid metabolism pdl00770   Pantothenate and CoA biosynthesis pdl01100   Metabolic pathways pdl01110   Biosynthesis of secondary metabolites pdl01210   2-Oxocarboxylic acid metabolism pdl01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:pdl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     Pyrde_1929    00660 C5-Branched dibasic acid metabolism     Pyrde_1929   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     Pyrde_1929   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     Pyrde_1929 Enzymes [BR:pdl01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      Pyrde_1929 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 PEP-utilizers_C bHLH-TF_ACT-like_plant Motif Other DBs NCBI-ProteinID:  ALL01972 UniProt:  A0A0P0N5A6 LinkDB All DBs Position complement(1919175..1919426) Genome browser AA seq 83 aa AA seqDB search MAAQGIGIYVIEVSAFNGMDAIMRLSNMARRAKLEYRNISASFDGRVVRMRIEAVGEEKE VRWLAAKMERMPEVYAVAAKRLS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtggcggcacaaggcatcgggatatacgtgatagaggtatcagcgtttaatggtatggac gccataatgaggctaagcaacatggcgcgccgggccaagctggaataccgcaacataagt gctagcttcgacggcagagtcgtcagaatgcgtatagaggctgtgggcgaggagaaggaa gtgcgctggctagcagccaagatggagaggatgcctgaagtctacgcggtggcggccaag agactatcgtag

DBGET integrated database retrieval system