Penicillium digitatum: PDIP_00590 Help Entry PDIP_00590        CDS       T04849                                  Name (RefSeq) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pdp  Penicillium digitatum Pathway pdp04145   Phagosome pdp04148   Efferocytosis pdp04620   Toll-like receptor signaling pathway pdp05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pdp00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PDIP_00590    04148 Efferocytosis     PDIP_00590  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     PDIP_00590  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     PDIP_00590  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pdp04131]     PDIP_00590   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pdp04147]     PDIP_00590    04031 GTP-binding proteins [BR:pdp04031]     PDIP_00590 Membrane trafficking [BR:pdp04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     PDIP_00590  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     PDIP_00590   Macropinocytosis    Ras GTPases     PDIP_00590  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     PDIP_00590 Exosome [BR:pdp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    PDIP_00590   Exosomal proteins of other body fluids (saliva and urine)    PDIP_00590   Exosomal proteins of colorectal cancer cells    PDIP_00590   Exosomal proteins of bladder cancer cells    PDIP_00590 GTP-binding proteins [BR:pdp04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     PDIP_00590 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  26228382 NCBI-ProteinID:  XP_014538808 UniProt:  K9GM61 A0A7T6XV58 LinkDB All DBs Position Unknown AA seq 201 aa AA seqDB search MATGPATQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYTASVMVDGRPISLG LWDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWFPEIEHHAPNVPIILVG TKLDLRDDPATTQALHARKMETVSYEQALAVAKEIRAHKYLECSALTQRNLKSVFDEAIR AVLNPRPTTKSGRKAAKCNIL NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atggcgacgggtccggctactcagtcactgaagtgtgtggtgactggtgatggtgcagtt ggcaaaacatgtcttctgatctcgtacacaacgaatgctttcccgggtgaatacatccct actgtctttgacaactacacggccagtgttatggttgacggccggccgatcagcctggga ctgtgggatactgctggacaagaggattacgatcgtttgagaccgttatcttacccgcaa accgacgtctttttgatctgcttctccatcgtcagcccaccgtcatttgataacgtcaaa gcaaagtggttccctgagatcgaacaccacgccccaaatgtccccatcatcctcgtcggt accaagctcgatctgagggacgaccccgccaccacgcaagcccttcacgcacgtaagatg gagaccgtctcctacgaacaagccctagccgtggccaaggagattcgcgcacataagtac cttgaatgttcggctctgacacaacgcaacttgaagagcgtgttcgacgaagccatccgg gccgttctcaacccccgtcccactacaaaatccgggaggaaggcagccaaatgcaatatc ttgtag

DBGET integrated database retrieval system