Penicillium digitatum: PDIP_34700 Help Entry PDIP_34700        CDS       T04849                                  Name (RefSeq) Autophagy-related protein 8   KO K08341   GABA(A) receptor-associated protein Organism pdp  Penicillium digitatum Pathway pdp04136   Autophagy - other pdp04138   Autophagy - yeast pdp04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:pdp00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     PDIP_34700    04136 Autophagy - other     PDIP_34700    04139 Mitophagy - yeast     PDIP_34700  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pdp04131]     PDIP_34700    04121 Ubiquitin system [BR:pdp04121]     PDIP_34700    03029 Mitochondrial biogenesis [BR:pdp03029]     PDIP_34700 Membrane trafficking [BR:pdp04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     PDIP_34700 Ubiquitin system [BR:pdp04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    PDIP_34700 Mitochondrial biogenesis [BR:pdp03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     PDIP_34700 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Hanta_Gn-B Motif Other DBs NCBI-GeneID:  26231788 NCBI-ProteinID:  XP_014535302 UniProt:  K9GPP9 A0A7T6XKA3 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYADRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDL NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgcgatccaagttcaaggacgagcaccccttcgaaaagcgaaaggccgaggctgagcgc atccgccagaaatatgcggaccggattcctgtcatctgcgagaaggtcgagaagtcagat atcgccacgattgataaaaagaagtacttagtgccggccgacctcaccgtgggacagttt gtctatgtgatccgcaagcgcataaagctctctcccgagaaggctatcttcatcttcgtt gatgaggtcctccctccaactgctgcgctcatgagcagtatctacgaagagcacaaggac gaagatggcttcttgtacatcacatactcgggcgagaacacattcggtgacctgtag

DBGET integrated database retrieval system