KEGG   Penicillium digitatum: PDIP_39980
Entry
PDIP_39980        CDS       T04849                                 

Definition
(RefSeq) hypothetical protein
  KO
K23668  fumiquinazoline A oxidase [EC:1.5.3.-]
Organism
pdp  Penicillium digitatum
Pathway
pdp00998  Biosynthesis of various secondary metabolites - part 2
pdp01100  Metabolic pathways
pdp01110  Biosynthesis of secondary metabolites
Module
pdp_M00901  Fumiquinazoline biosynthesis, tryptophan + alanine + anthranilate => fumiquinazoline
Brite
KEGG Orthology (KO) [BR:pdp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    PDIP_39980
Enzymes [BR:pdp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.-  
     PDIP_39980
SSDB
Motif
Pfam: FAD_binding_4 BBE
Other DBs
NCBI-GeneID: 26232316
NCBI-ProteinID: XP_014534989
UniProt: K9G0Z1
LinkDB
Position
Unknown
AA seq 489 aa
MRSYLISILAGLPILARSTLALASRDEVPDFKAIFSPVLSSGAHLYLPGDPEYFKVNERW
SNLEDPQYVAAIQPATELDVKNIVSAATKHNISFLATGSGHSVKPGYASVKRAVNIDLSL
LKNIALGYDTNTVTIGPGVKNSQVYDVVYDVKKELPLSTDRCISTIGTMIGGGLGTLYSA
RGLLADSLISANVVTAAGDLVTASSTENPDLFWAIRGAGHNFGIVTSATFKIYDQTNGGN
SLVGDFVIPSSQNASVFEILKSVDENLEPNVFWGILVGFNHTTKDADIHLRLIVQGGDED
AAPHLAKAKALNPTVTSWENTTWNAFGEPTEIMCNTGWNSNMYQMGLKKTDVDTLVSFFD
DWSTFSAENDWYNGLIMMERHSEKKVMSVPKEEQGVFPWRDTKIQMILVNYMTDQKYAGK
LNNFMQPVRAEIQSAMGFENHHSYVNEAYGDEGPKVWYGEHNLPRLVAAKQKWDPTDQFG
PGMPVPLSL
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgcgatcgtatttaatatcaatcctcgcgggattgccgattctagcgaggtcaacattg
gcacttgctagccgagacgaagtccctgatttcaaggctatcttcagtccagtgttgtct
tctggtgcccatctctacctcccgggtgacccggaatacttcaaggtcaatgaaagatgg
tccaaccttgaagaccctcagtatgttgctgctatccaaccagcaaccgagctcgatgtg
aaaaacattgtttcagcggccacgaagcataatatctcctttctcgccaccgggtcaggt
cacagtgtcaaaccaggctatgcttctgttaaaagagctgtgaatatcgacctcagccta
ctgaaaaacatcgctttgggttatgacaccaacaccgtgactattggaccgggagtaaag
aacagccaggtgtacgatgttgtgtatgatgtgaaaaaggaactccctcttagcacggat
cgctgcattagcacgattggcacgatgattggaggtggcttgggaactctttacagcgct
cgtggtcttttggcagactctctgatctcagccaacgttgtcactgccgcaggagacttg
gtcaccgcctcatcgaccgaaaatccggatctcttctgggccatccgcggagccggtcac
aactttggcatcgtcacctcggccacgttcaaaatctacgaccagaccaatggtggcaac
agtctagttggtgactttgtgatccccagctcccagaatgcctcggtgtttgagatattg
aagtcagtggatgagaacctcgagcccaacgtcttttggggaattcttgtcggtttcaac
cacacgaccaaggatgctgacattcatctccgtttaattgtccaaggtggcgacgaagat
gctgctcctcatctcgccaaagcaaaagccctcaacccaacagtcacctcctgggagaac
accacgtggaacgcctttggcgaaccaacagagatcatgtgcaatacaggctggaattcc
aacatgtaccagatgggtttaaagaaaactgacgtggacacgttggtttcgttcttcgac
gattggagcaccttctctgccgagaacgactggtacaatgggctgatcatgatggaaaga
cactctgaaaagaaggtcatgtcggttccaaaggaggagcaaggcgtcttcccatggcga
gataccaaaatccagatgatcctcgtcaactacatgaccgaccagaaatatgctggtaag
ctcaacaactttatgcaaccggttcgcgcagaaatccagagcgcgatgggattcgaaaac
caccacagctatgtcaatgaggcatacggcgatgaaggtccgaaagtgtggtacggagag
cacaacttgcccaggctggtggcggcgaagcagaagtgggatccgactgatcaatttgga
cctggaatgcctgtgccactgagtctctag

DBGET integrated database retrieval system