Polynucleobacter duraquae: CL55_00000170 Help Entry CL55_00000170     CDS       T04207                                  Name (GenBank) ATP synthase, F0 subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism pdq  Polynucleobacter duraquae Pathway pdq00190   Oxidative phosphorylation pdq01100   Metabolic pathways Module pdq_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pdq00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CL55_00000170  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pdq00194]     CL55_00000170 Photosynthesis proteins [BR:pdq00194]  Photosystem and electron transport system   F-type ATPase [OT]    CL55_00000170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AKD24350 UniProt:  A0A0E3ZJJ5 LinkDB All DBs Position 16752..17018 Genome browser AA seq 88 aa AA seqDB search MQAFLANIQGLTAIGIGLIIGLGALGACLGIGIMGGKFIEGAARQPELINELQTKMFLLA GLIDAAFLIGVGVAMLFAFANPLLAVIK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcaagcattcttagccaacatccaaggactaaccgctatcggtattggcctcatcatc ggcctcggcgcattgggagcctgtttgggcattggcataatgggcggtaagttcattgag ggcgctgcccgtcaaccagaattgatcaacgagctacaaaccaaaatgttccttttggct ggtttgatcgatgctgcgttcttgatcggcgttggtgttgcaatgctgtttgcttttgca aacccactgctcgcagttattaagtaa

DBGET integrated database retrieval system