Polynucleobacter duraquae: CL55_00015210 Help Entry CL55_00015210     CDS       T04207                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pdq  Polynucleobacter duraquae Pathway pdq01100   Metabolic pathways pdq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pdq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CL55_00015210    00074 Mycolic acid biosynthesis     CL55_00015210   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CL55_00015210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 DUF1896 DUF5783 Motif Other DBs NCBI-ProteinID:  AKD25854 UniProt:  A0A0E3V158 LinkDB All DBs Position complement(1484337..1484576) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNESSFVNDLGADSLDTVELVMALEDEFGIEIPDEEA EKITTVQLAIDFAQSKAQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataacatcgaacaacgcgttaagaagatcgtcgctgagcaattgggcgtcgcagaa gcagagatcaagaatgaatcttcttttgtgaatgacttaggcgcagactctcttgacact gttgaattggtaatggctttggaagatgaattcgggattgaaattcctgatgaagaagct gaaaaaattactactgttcagctcgctatcgattttgctcagtcaaaagctcagggttaa

DBGET integrated database retrieval system