Pseudomonas sp. ATCC 13867: H681_05595 Help Entry H681_05595        CDS       T02524                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism pdr  Pseudomonas sp. ATCC 13867 Brite KEGG Orthology (KO) [BR:pdr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pdr03036]     H681_05595 Chromosome and associated proteins [BR:pdr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     H681_05595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Motif Other DBs NCBI-ProteinID:  AGI22999 UniProt:  M4WTB3 LinkDB All DBs Position 1223453..1223746 Genome browser AA seq 97 aa AA seqDB search MSRLFVKRLPAGSFFMLLLFIGVLLSAISVSYSAYWNRQLLNALYAELSVRDKAQAEYGR LILEQSTWTAHSRIEALATDQLKMRVPDPTEVIMVAP NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgagccgcctcttcgtcaagcgcctgccggccggcagcttcttcatgctgttgctgttc attggtgtgctgctatcggcgatttccgtttcctacagcgcgtactggaaccgccagttg ctcaacgctctgtatgccgaactgagcgtgcgtgacaaggcgcaggccgaatatggccgg ctgatcctggagcagagcacctggacggcgcacagccgcatcgaagcgctggccaccgac cagttgaagatgcgcgtgccggatccgaccgaagtcatcatggtggcgccatga

DBGET integrated database retrieval system