KEGG   Pseudomonas sp. ATCC 13867: H681_05755
Entry
H681_05755        CDS       T02524                                 
Symbol
groEL
Name
(GenBank) chaperonin GroEL
  KO
K04077  chaperonin GroEL
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    H681_05755 (groEL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pdr03019]
    H681_05755 (groEL)
   03110 Chaperones and folding catalysts [BR:pdr03110]
    H681_05755 (groEL)
   03029 Mitochondrial biogenesis [BR:pdr03029]
    H681_05755 (groEL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pdr04147]
    H681_05755 (groEL)
Messenger RNA biogenesis [BR:pdr03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     H681_05755 (groEL)
Chaperones and folding catalysts [BR:pdr03110]
 Heat shock proteins
  HSP60 / Chaperonin
   H681_05755 (groEL)
Mitochondrial biogenesis [BR:pdr03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    H681_05755 (groEL)
Exosome [BR:pdr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   H681_05755 (groEL)
  Exosomal proteins of other body fluids (saliva and urine)
   H681_05755 (groEL)
  Exosomal proteins of breast cancer cells
   H681_05755 (groEL)
  Exosomal proteins of colorectal cancer cells
   H681_05755 (groEL)
  Exosomal proteins of bladder cancer cells
   H681_05755 (groEL)
SSDB
Motif
Pfam: Cpn60_TCP1
Other DBs
NCBI-ProteinID: AGI23031
UniProt: M4WV17
LinkDB
Position
1259248..1260888
AA seq 546 aa
MAAKEVKFGDSARKKMLVGVNVLADAVKATLGPKGRNVILDKSFGAPTITKDGVSVAKEI
ELKDKFENMGAQLVKDVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGI
DKATIAIVAQLKDLAKPCADTKAIAQVGTISANSDDSIGNIIAEAMEKVGKEGVITVEEG
SGLENELSVVEGMQFDRGYLSPYFINKPDTMVAELEGPLLLLVDKKISNIREMLPVLEAV
AKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPGFGDRRKAMLQDIAILTGGTV
ISEEVGLSLEGATLEHLGNAKRVVLSKENTTIIDGAGAQADIEARVLQIRKQVEETSSDY
DREKLQERLAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVPGGGVALV
RALQAIEGLKGDNEDQNVGIALLRRAVEAPLRQIVANSGDEPSVVVDKVKQGSGNFGYNA
ATGVYGDMIEMGILDPAKVTRSALQAAASIGGLMVTTEAMVAEVIDDKAVPAMPDMGGMG
GMGGMM
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggctgccaaagaagttaagttcggcgattccgctcgcaagaaaatgctggtcggcgta
aacgtcctggccgacgcggtcaaggcgaccctgggcccgaaaggccgtaacgtcatcctg
gacaagagcttcggcgctccgaccatcaccaaggacggcgtttccgttgccaaggaaatc
gaactcaaagacaagttcgagaacatgggcgcccaactggtgaaagacgttgcctccaag
gccaacgacgctgccggtgacggcaccaccaccgcgaccgttctggctcaggccatcgtc
aacgaaggcctgaaggccgtcgctgccggcatgaacccgatggacctcaagcgcggcatc
gacaaggcgaccatcgccatcgttgcccagctcaaggatctggccaagccgtgtgccgac
accaaggccatcgcccaggtcggcaccatctccgccaactccgacgactccatcggcaac
atcattgccgaagcgatggaaaaggttggcaaggaaggcgtgatcaccgttgaagaaggc
tcgggcctggaaaacgagctgtccgtcgtagaaggcatgcagttcgaccgcggctacctg
tccccctacttcatcaacaagccggacaccatggtggccgagcttgaaggcccgctgctg
ctgctggtcgacaagaaaatctccaacatccgcgaaatgctgccggtcctggaagccgtt
gccaaagccggccgtccgctgctgatcgtggctgaagacgtcgaaggcgaagccctggct
accctggtcgtcaacaacatgcgtggcatcgtcaaggtcgcggccgtcaaggctccgggc
ttcggcgaccgccgcaaggccatgctgcaggacatcgccatcctgaccggcggcaccgtc
atctccgaagaagtcggtctgagcctggaaggcgccaccctggagcacctgggcaacgcc
aagcgcgtcgtcctgagcaaggaaaacaccaccatcatcgacggcgctggcgcccaggct
gatatcgaagcccgcgtcctgcagatccgcaagcaggtcgaagagacctcctcggactac
gaccgtgagaagctgcaagagcgtctggccaagctggccggcggtgttgccgtgatcaag
gtcggcgctgccaccgaagtcgagatgaaagagaagaaagcccgcgttgaagacgccctg
cacgctacccgcgctgctgtggaagaaggcgtggttcctggcggtggcgtcgctctggtt
cgtgctctgcaagccatcgaaggcctgaagggcgacaacgaagaccagaacgtcggtatc
gctctgctgcgtcgcgccgttgaagcgccgctgcgccagatcgttgccaactccggcgac
gagccgagcgtagtggtcgacaaggtcaagcagggttcgggcaacttcggctacaacgct
gctaccggcgtgtacggcgacatgatcgagatgggtatcctcgatccggccaaggtcacc
cgttcggctctgcaagccgctgcttccatcggcggcctgatggtcaccaccgaggcgatg
gttgccgaagtgatcgacgacaaggctgttccggccatgccggacatgggcggcatgggt
ggcatgggcggtatgatgtaa

DBGET integrated database retrieval system