Pseudomonas sp. ATCC 13867: H681_08750 Help Entry H681_08750        CDS       T02524                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism pdr  Pseudomonas sp. ATCC 13867 Pathway pdr02020   Two-component system pdr02025   Biofilm formation - Pseudomonas aeruginosa pdr02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pdr00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     H681_08750  09140 Cellular Processes   09145 Cellular community - prokaryotes    02025 Biofilm formation - Pseudomonas aeruginosa     H681_08750   09142 Cell motility    02040 Flagellar assembly     H681_08750  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pdr02035]     H681_08750 Bacterial motility proteins [BR:pdr02035]  Flagellar system   Flagellar assembly proteins    Others     H681_08750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF4404 Motif Other DBs NCBI-ProteinID:  AGI23624 UniProt:  M4WV02 LinkDB All DBs Position complement(1918986..1919300) Genome browser AA seq 104 aa AA seqDB search MVIDFNRLNPASTPATTGRSGAAQNGRSEAPAEPATANAPTKSGESVQLSDTAQQLQKVS DQLKDQPVVDKEKVARIKQAIADGSYQVDSQKVASKLLDFESQR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggttatcgacttcaaccggctgaacccggcctctacgccagccaccactggccgtagc ggtgctgcgcagaacggtcgcagcgaagccccggccgagcccgccaccgccaacgctccg accaagagcggcgaatcggtacagctcagcgataccgcccagcagttgcagaaagtcagc gatcaactgaaggaccagcccgtggtcgacaaggaaaaggtggcccgcatcaagcaggcg atcgccgatggcagctatcaggtcgacagccagaaagtcgccagcaagctgctcgatttc gagtcccagcgctga

DBGET integrated database retrieval system