KEGG   Pseudomonas sp. ATCC 13867: H681_16210
Entry
H681_16210        CDS       T02524                                 
Name
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00520  Amino sugar and nucleotide sugar metabolism
pdr01100  Metabolic pathways
pdr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    H681_16210
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    H681_16210
Enzymes [BR:pdr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     H681_16210
SSDB
Motif
Pfam: Glyco_hydro_3
Other DBs
NCBI-ProteinID: AGI25110
UniProt: M4XIH5
LinkDB
Position
complement(3659166..3660164)
AA seq 332 aa
MQGSLMLDIGGTWLTAEDRQILRHPEVGGLIIFARNIESPRQVRELCAAIRAVRPDLLLA
VDQEGGRVQRLRQGFLRLPAMRAIADNANAERLAEQCGWLMATEVLAVGLDLSFAPVLDL
DHQRSAVVGSRAFEGSPERAVALAGAFIRGMHAAGMAATGKHFPGHGWAEVDSHVGIPED
ERSLEEIRACDLVPFQRLSGELDALMPAHVIYPRVDPNPAGFSRRWLQDILRGELGFDGV
IFSDDLSMAGAHVVGDAANRIEAALNAGCDMGLVCNDRASAELALSALQRLKVTAPARLQ
RMRARAWPGAEYKQLPRWQQAVGELRAAQLID
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcaaggctccctgatgctcgacatcggcggcacctggctgaccgccgaggaccgccag
atcctgcgccacccggaagtgggcggcctgatcatcttcgcccgcaacatcgagtcgccg
cgccaggtgcgcgagctctgcgcagccatccgcgcggtgcgcccggatctgctgctggca
gtggatcaggaaggcggtcgggtgcagcgtctgcgccagggcttcctgcgcctgccggcg
atgcgcgccattgccgacaacgccaatgccgagcgcctggccgaacagtgcggctggctg
atggcgaccgaagtgctggcggtggggctggacctcagtttcgctccggtgctggacctg
gatcaccagcgcagcgcggtggtcggcagccgcgccttcgagggcagccccgagcgcgcg
gtcgcgctggccggcgccttcatccgaggcatgcacgctgccggtatggcggccaccggc
aagcacttccccggccacggctgggcggaggtcgactcccatgtgggaatcccggaggac
gagcgcagcctggaagagatccgcgcctgtgacctggtcccgttccagcgcctgtcgggc
gagctggatgcgctgatgccggcccatgtgatctacccgcgggtcgacccgaatcccgcc
ggcttctcccggcgctggctgcaggacatcctgcgcggcgagctgggcttcgacggagtg
atcttcagcgacgacctgtctatggccggcgcccatgtggtgggcgatgccgccaatcgc
atcgaggccgcgctgaacgccggttgcgacatgggcctggtgtgtaatgatcgcgcctcc
gccgagttggccctgagcgcgttgcagcgcctgaaggtcactgcgccggcgcgcctgcaa
cgcatgcgcgccagggcctggccgggtgccgagtacaagcagctgccgcgctggcagcag
gccgtgggcgaactgcgcgccgcacaactgatcgactaa

DBGET integrated database retrieval system